DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL14 and Mrpl14

DIOPT Version :9

Sequence 1:NP_001259186.1 Gene:mRpL14 / 31222 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_008765071.1 Gene:Mrpl14 / 301250 RGDID:1306240 Length:155 Species:Rattus norvegicus


Alignment Length:156 Identity:75/156 - (48%)
Similarity:100/156 - (64%) Gaps:19/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PLAVTLG---------GQQTQQLIHTTPACCEIRKLARLRVVDNSDLGKKAMAEGRPPRCIHVYN 70
            |:||..|         |..:|:...|:.:...|:|:.|:||||||.||....  .||||||||||
  Rat    10 PMAVLTGLFGFFAYVRGAVSQRCFSTSGSLSAIQKMTRVRVVDNSALGNTPY--HRPPRCIHVYN 72

  Fly    71 KRGVGFIGDKVLVAIKGQMKKGILVGLKQNQKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTIL 135
            |.|||.:||::|:||:||.||.::||.:.......|||||||:|||:|||:|:||||.:||||.|
  Rat    73 KSGVGKVGDQILLAIRGQKKKALIVGHRMPGSRMTPKFDSNNVVLIEDNGNPVGTRIKIPIPTSL 137

  Fly   136 RTILKEKTLAKGADYTKVLAIASRYV 161
            |        .:..:|:||||||..:|
  Rat   138 R--------RREGEYSKVLAIAQNFV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 67/120 (56%)
Mrpl14XP_008765071.1 Ribosomal_L14 42..152 CDD:294234 66/119 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351793
Domainoid 1 1.000 124 1.000 Domainoid score I5418
eggNOG 1 0.900 - - E1_KOG3441
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12268
Inparanoid 1 1.050 136 1.000 Inparanoid score I4468
OMA 1 1.010 - - QHG48481
OrthoDB 1 1.010 - - D1547267at2759
OrthoFinder 1 1.000 - - FOG0005521
OrthoInspector 1 1.000 - - oto97821
orthoMCL 1 0.900 - - OOG6_108936
Panther 1 1.100 - - LDO PTHR21037
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3941
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.