DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL14 and rpl-23

DIOPT Version :10

Sequence 1:NP_525048.1 Gene:mRpL14 / 31222 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_498231.1 Gene:rpl-23 / 175796 WormBaseID:WBGene00004435 Length:140 Species:Caenorhabditis elegans


Alignment Length:84 Identity:22/84 - (26%)
Similarity:40/84 - (47%) Gaps:20/84 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IHVYNKRG-------VGFIGDKVLVAI---KGQMKKGILVGLKQNQKPKQPK--------FDSNN 112
            |.||..||       .| :||..:.::   |.:::|.:|.|:...|: ||.:        |:.|.
 Worm    40 ISVYGIRGRLNRLPSAG-VGDMFVCSVKKGKPELRKKVLQGVVIRQR-KQFRRKDGTFIYFEDNA 102

  Fly   113 LVLIDDNGSPLGTRIHVPI 131
            .|::::.|...|:.|..|:
 Worm   103 GVIVNNKGEMKGSAITGPV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL14NP_525048.1 Ribosomal_uL14 39..136 CDD:466774 22/84 (26%)
rpl-23NP_498231.1 PTZ00054 2..139 CDD:185418 22/84 (26%)

Return to query results.
Submit another query.