DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL14 and mrpl14

DIOPT Version :9

Sequence 1:NP_001259186.1 Gene:mRpL14 / 31222 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001165105.1 Gene:mrpl14 / 100124892 XenbaseID:XB-GENE-970368 Length:144 Species:Xenopus tropicalis


Alignment Length:137 Identity:71/137 - (51%)
Similarity:92/137 - (67%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TQQLIHTTPACCEIRKLARLRVVDNSDLGKKAMAEGRPPRCIHVYNKRGVGFIGDKVLVAIKGQM 89
            |.|.:..:..|..|:||.|:||||||.||  :....|||:|||||||.|||.:||::|:|||||.
 Frog    18 TIQHLSLSAPCGAIQKLTRVRVVDNSTLG--STPYHRPPKCIHVYNKSGVGKVGDRILLAIKGQK 80

  Fly    90 KKGILVGLKQNQKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILKEKTLAKGADYTKVL 154
            ||.::||.|.......|:|||||:|||:|||:|:||||..||||.||        ....:::|||
 Frog    81 KKALIVGHKMPGASMTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLR--------RHDGEFSKVL 137

  Fly   155 AIASRYV 161
            |||..:|
 Frog   138 AIAQNFV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 67/120 (56%)
mrpl14NP_001165105.1 Ribosomal_L14 32..140 CDD:412313 64/117 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12268
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1547267at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21037
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3812
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.140

Return to query results.
Submit another query.