DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and VIK

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_172853.1 Gene:VIK / 837960 AraportID:AT1G14000 Length:438 Species:Arabidopsis thaliana


Alignment Length:309 Identity:101/309 - (32%)
Similarity:153/309 - (49%) Gaps:61/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 NWNILAEEILI--GPRIGSGSFGTVYRAHWHG-PVAVKTLNVKTPSPAQ----LQAFKNEVAMLK 478
            :|.|...|:..  ...||.||||.:.:|:|.| |||||.:   .||.:.    :|.|::||.:|.
plant   152 DWEIEPAELDFSNAAMIGKGSFGEIVKAYWRGTPVAVKRI---LPSLSDDRLVIQDFRHEVDLLV 213

  Fly   479 KTRHCNILLFMGCVS--KPSLAIVTQWCEGSSLYKHVHVSETKFKL--NTLIDIGRQVAQGMDYL 539
            |.||.||:.|:|.|:  || |.::|::..|..|::::   :.|..|  .|.::....:|:||.||
plant   214 KLRHPNIVQFLGAVTERKP-LMLITEYLRGGDLHQYL---KEKGGLTPTTAVNFALDIARGMTYL 274

  Fly   540 HAKN--IIHRDLKSNNIFLHEDLS--VKIGDFGLATA--------KTRWSGEKQANQPTGSILWM 592
            |.:.  |||||||..|:.|....:  :|:|||||:..        ..:.:||      |||..:|
plant   275 HNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGE------TGSYRYM 333

  Fly   593 APEVIRMQELNPYSFQSDVYAFGIVMYELL------AECLPY---GHISNKDQILFMVGRGLLRP 648
            ||||.:.:.   |..:.||::|.:::||:|      |...||   .|:|:..:..|. .:| ..|
plant   334 APEVFKHRR---YDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFR-SKG-CTP 393

  Fly   649 DMSQVRSDAPQALKRLAEDCIKYTPKDRPLFRPLLNMLENMLRTLPKIH 697
            |           |:.|...|.......||.|..:|..||.:..|||..|
plant   394 D-----------LRELIVKCWDADMNQRPSFLDILKRLEKIKETLPSDH 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 92/281 (33%)
VIKNP_172853.1 ANK repeat 36..68 CDD:293786
PTZ00322 45..>126 CDD:140343
ANK repeat 70..101 CDD:293786
ANK repeat 103..127 CDD:293786
STKc_MAP3K-like 168..420 CDD:270901 92/280 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.