DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and VIK

DIOPT Version :10

Sequence 1:NP_525047.1 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_172853.1 Gene:VIK / 837960 AraportID:AT1G14000 Length:438 Species:Arabidopsis thaliana


Alignment Length:309 Identity:101/309 - (32%)
Similarity:153/309 - (49%) Gaps:61/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 NWNILAEEILI--GPRIGSGSFGTVYRAHWHG-PVAVKTLNVKTPSPAQ----LQAFKNEVAMLK 478
            :|.|...|:..  ...||.||||.:.:|:|.| |||||.:   .||.:.    :|.|::||.:|.
plant   152 DWEIEPAELDFSNAAMIGKGSFGEIVKAYWRGTPVAVKRI---LPSLSDDRLVIQDFRHEVDLLV 213

  Fly   479 KTRHCNILLFMGCVS--KPSLAIVTQWCEGSSLYKHVHVSETKFKL--NTLIDIGRQVAQGMDYL 539
            |.||.||:.|:|.|:  || |.::|::..|..|::::   :.|..|  .|.::....:|:||.||
plant   214 KLRHPNIVQFLGAVTERKP-LMLITEYLRGGDLHQYL---KEKGGLTPTTAVNFALDIARGMTYL 274

  Fly   540 HAKN--IIHRDLKSNNIFLHEDLS--VKIGDFGLATA--------KTRWSGEKQANQPTGSILWM 592
            |.:.  |||||||..|:.|....:  :|:|||||:..        ..:.:||      |||..:|
plant   275 HNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGE------TGSYRYM 333

  Fly   593 APEVIRMQELNPYSFQSDVYAFGIVMYELL------AECLPY---GHISNKDQILFMVGRGLLRP 648
            ||||.:.:.   |..:.||::|.:::||:|      |...||   .|:|:..:..|. .:| ..|
plant   334 APEVFKHRR---YDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFR-SKG-CTP 393

  Fly   649 DMSQVRSDAPQALKRLAEDCIKYTPKDRPLFRPLLNMLENMLRTLPKIH 697
            |           |:.|...|.......||.|..:|..||.:..|||..|
plant   394 D-----------LRELIVKCWDADMNQRPSFLDILKRLEKIKETLPSDH 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_525047.1 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 92/281 (33%)
VIKNP_172853.1 ANK repeat 36..68 CDD:293786
ANKYR <38..>127 CDD:440430
ANK repeat 70..101 CDD:293786
ANK repeat 103..127 CDD:293786
STKc_MAP3K-like 168..420 CDD:270901 92/280 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.