DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and STY46

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_568041.1 Gene:STY46 / 830003 AraportID:AT4G38470 Length:575 Species:Arabidopsis thaliana


Alignment Length:276 Identity:97/276 - (35%)
Similarity:156/276 - (56%) Gaps:20/276 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 WNILAEEILIGPRIGSGSFGTVYRAHWHGPVAVKTLNVKTPSPAQLQA-----FKNEVAMLKKTR 481
            |.|..:.:..|.:|.|||:|.:|:    |....:.:.:|...|.:|.:     |..||.:::|.|
plant   283 WEINLKHLKFGHKIASGSYGDLYK----GTYCSQEVAIKVLKPERLDSDLEKEFAQEVFIMRKVR 343

  Fly   482 HCNILLFMG-CVSKPSLAIVTQWCEGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLHAKNII 545
            |.|::.|:| |...|.|.|||::..|.|:|.::|..:..|||.||..:...:.:||.|||..|||
plant   344 HKNVVQFIGACTKPPHLCIVTEFMPGGSVYDYLHKQKGVFKLPTLFKVAIDICKGMSYLHQNNII 408

  Fly   546 HRDLKSNNIFLHEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSD 610
            |||||:.|:.:.|:..||:.|||:|..|.: :|...|.  ||:..|||||||   |..||..::|
plant   409 HRDLKAANLLMDENEVVKVADFGVARVKAQ-TGVMTAE--TGTYRWMAPEVI---EHKPYDHKAD 467

  Fly   611 VYAFGIVMYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTPKD 675
            |:::|||::|||...|||.:::.....:.:|.:| |||.:.  ::..|: |..|.|...::....
plant   468 VFSYGIVLWELLTGKLPYEYMTPLQAAVGVVQKG-LRPTIP--KNTHPK-LAELLERLWEHDSTQ 528

  Fly   676 RPLFRPLLNMLENMLR 691
            ||.|..::..|:.:.:
plant   529 RPDFSEIIEQLQEIAK 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 93/257 (36%)
STY46NP_568041.1 ACT 176..241 CDD:415594
STKc_MAP3K-like 296..539 CDD:270901 93/256 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.