DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and AT4G18950

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_567568.1 Gene:AT4G18950 / 827630 AraportID:AT4G18950 Length:459 Species:Arabidopsis thaliana


Alignment Length:259 Identity:80/259 - (30%)
Similarity:133/259 - (51%) Gaps:19/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 GTVYRAHWHG-PVAVKTLNVKTPS-PAQLQAFKNEVAMLKKTRHCNILLFMGCVSKPS-LAIVTQ 502
            ||...|.|.| .||||.|:.:..| ..|::.|.:|:|:|::.||.||:.|:|.|::.: :.|||:
plant   169 GTYCMAMWRGIQVAVKKLDDEVLSDDDQVRKFHDELALLQRLRHPNIVQFLGAVTQSNPMMIVTE 233

  Fly   503 WCEGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLH---AKNIIHRDLKSNNIFLHEDLSVKI 564
            :.....| :.:...:.:.|..|.:.....:|:||.|||   ...||||||:.:||...:...:|:
plant   234 YLPRGDL-RELLKRKGQLKPATAVRYALDIARGMSYLHEIKGDPIIHRDLEPSNILRDDSGHLKV 297

  Fly   565 GDFG---LATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAFGIVMYELLAECL 626
            .|||   |.|.|.    :|.......|..::||||...:|   |..::||::|.:::.|::...:
plant   298 ADFGVSKLVTVKE----DKPFTCQDISCRYIAPEVFTSEE---YDTKADVFSFALIVQEMIEGRM 355

  Fly   627 PYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTPKDRPLFRPLLNMLENML 690
            |:....:.:......|:.  ||.......:.|..||.|.|:|....|..||.||.::..||::|
plant   356 PFAEKEDSEASEAYAGKH--RPLFKAPSKNYPHGLKTLIEECWHEKPAKRPTFREIIKRLESIL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 77/254 (30%)
AT4G18950NP_567568.1 ANK repeat 42..73 CDD:293786
Ank_2 47..134 CDD:372319
ANK repeat 75..106 CDD:293786
ANK repeat 108..133 CDD:293786
STKc_MAP3K-like 176..413 CDD:270901 74/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100006
Panther 1 1.100 - - O PTHR44329
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.