DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and AT3G59830

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_191542.2 Gene:AT3G59830 / 825152 AraportID:AT3G59830 Length:477 Species:Arabidopsis thaliana


Alignment Length:482 Identity:122/482 - (25%)
Similarity:199/482 - (41%) Gaps:107/482 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 RGTAVRFNMSS--RSRSRRCS--------------SSGSSSSSKP----PSSSSGNHRQGRPPRI 338
            ||.:.:|:..|  |:.||:.:              |.|..||..|    |.|.|..      |.:
plant    10 RGISRQFSTGSMRRTLSRQFTRQNSLDPRRNNMRFSFGRQSSLDPIRRSPESLSCE------PHM 68

  Fly   339 SQDDRSNSAPNVC-------INNIRSVTSE--VQRSLIMQARPPLPH--PCTDHSNSTQASPTST 392
            |..:..:|...:.       :|.:..:.:|  ...|:.:..|..| |  .|..|.:..:     .
plant    69 SVPENLDSTMQLLFMASKGDVNGVEELLNEGIDVNSIDLDGRTAL-HIASCEGHYDVVK-----V 127

  Fly   393 LKHNRPRARSADESNKNLLLRDAK--SSEENWNIL----------------------AEEILIGP 433
            |...|....:.|.......: |||  .:.|.:|:|                      ..|..:.|
plant   128 LLSRRANIDARDRWGSTAAV-DAKYYGNVEVYNLLKARGAKAPKTRKTPMTVGNPKEVPEYELNP 191

  Fly   434 ------RIGSGSFGTVYRAHWHGP-VAVKTLNVKTPS-PAQLQAFKNEVAMLKKTRHCNILLFMG 490
                  ::...|.||...|.|:|. |:||..:..:.| |.::.||.||:.:|.|.||.||:.|:|
plant   192 LELQVRKVDGISKGTYQVAKWNGTRVSVKIFDKDSYSDPERVNAFTNELTLLAKARHPNIVQFVG 256

  Fly   491 CVSK--PSLAIVTQWCEGS-SLY--KHVHVSETKFKLNTLIDIGRQVAQGMDYLH---AKNIIHR 547
            .|::  |.:.:|....:|. |:|  |...:|.:| .|...:||    |:||:|||   ...|||.
plant   257 AVTQNLPMMIVVECNPKGDLSVYLQKKGRLSPSK-ALRFALDI----ARGMNYLHECKPDPIIHC 316

  Fly   548 DLKSNNIFLHEDLSVKIGDFGLATAKTRWSGEKQAN------QPTGSILWMAPEVIRMQELNPYS 606
            :|...||.|.....:||..|||  .|....||..|.      |...|..::|||:.:.:   .:.
plant   317 ELMPKNILLDRGGQLKISGFGL--IKLSKIGEDSAKVVNHEAQIDKSNYYIAPEIYKDE---VFD 376

  Fly   607 FQSDVYAFGIVMYELLAECLPYGHISNKDQI---LFMVGRGLLRPDMSQVRSDAPQALKRLAEDC 668
            .::||::||:::|| |.|.:...|....:::   :.:.|:   ||.:.......|..||.|.|:|
plant   377 KRADVHSFGVILYE-LTEGVSLFHPKPPEEVAESICIEGK---RPTIRTKSKSYPPELKELIEEC 437

  Fly   669 IKYTPKDRPLFRPLLNMLENMLRTLPK 695
            .......||:|..::..|:.::....|
plant   438 WHPEISVRPIFSEIIIRLDKIVTNCSK 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 83/270 (31%)
AT3G59830NP_191542.2 Ank_2 80..167 CDD:403870 17/93 (18%)
ANK repeat 80..106 CDD:293786 3/25 (12%)
ANK repeat 108..139 CDD:293786 7/36 (19%)
ANK repeat 141..166 CDD:293786 6/25 (24%)
PKc_like 202..455 CDD:419665 83/266 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.