DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and AT3G58640

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_567072.1 Gene:AT3G58640 / 825033 AraportID:AT3G58640 Length:809 Species:Arabidopsis thaliana


Alignment Length:722 Identity:163/722 - (22%)
Similarity:278/722 - (38%) Gaps:217/722 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SESSTEGDSDLYD------PLAEELHNVQLVKHVTRENID-----ALNAKF---ANLQEPPA--M 51
            |..|..|:||..:      ||..........:....||.:     :|:.|.   .|...||:  |
plant   259 SHISAAGESDSAENDSCDSPLEPNSPMFGYPEKFDHENAEKDENLSLHRKLDGSPNTSGPPSRNM 323

  Fly    52 YLIEYQELTSKLHELEAKEQELME------RLNSQDQQEDSSLVERFKEQPHYQNQTQ-ILQQQR 109
            .|.....|..||...:::.....|      |....||:..||..|...    ::.:|: :|...:
plant   324 LLRSASALERKLSFSQSESNMANEFWRQSRRKVIADQRTASSSPEHLS----FRARTKSMLSGDK 384

  Fly   110 QLARVHHGNDLTDSLGSQPGSQCGTLTRQPKILLRAHLPNQQRTSVEVISGVRLCDALMKALKLR 174
            .|||...|:..|.|..|..|::..|     |.:.|..:........:::..||   |:.:|||..
plant   385 NLARDFTGDVATSSCKSVGGAKMET-----KRIRRRSISITPEIGDDIVRAVR---AMNEALKQN 441

  Fly   175 QLTPDMCEVSTTHSGRHIIPWHTDIGTLHVEEIFVRLLDKFPIRTHIKHQIIRKTFFSLVFCEGC 239
            :|:.:..:..::.:..:                         .||...|  ::|.          
plant   442 RLSKEQGDDDSSPNSPN-------------------------DRTESSH--LQKN---------- 469

  Fly   240 RRLLFTGFYCSQCNFRFHQRCANRVPMLCQPFPMDSYYQLLLAENPDNGVGFPGRGTAVRFNMSS 304
                .:||:                        :|::.|:                         
plant   470 ----VSGFH------------------------LDAHDQV------------------------- 481

  Fly   305 RSRSRRCSSSGSSSSSKPP---------SSSSGNHRQGRPPRISQDDRSNSAPNVCINNIRSVTS 360
                    |.|.|:.|:.|         .||..|:|       ||.::|.|:.    .||..:..
plant   482 --------SGGRSTLSREPLDPQKAISLPSSPQNYR-------SQYEQSGSSH----RNISHIWD 527

  Fly   361 EVQRSLIMQARPPLPHPCTDHSNSTQASPTSTLKHNRPRARSADESNKNLLLRDAKSSEENWNIL 425
            :|..|.:.|.:|.||:                                           |.|||.
plant   528 KVLGSPMFQNKPLLPY-------------------------------------------EEWNID 549

  Fly   426 AEEILIGPRIGSGSFGTVYRAHWHG-PVAVKTLNVKTPSPAQLQAFKNEVAMLKKTRHCNILLFM 489
            ..|:.:|.|:|.|.||.|:|..|:| .||:|....:..:...::.|.||:::|.:.||.|::||:
plant   550 FSELTVGTRVGIGFFGEVFRGIWNGTDVAIKVFLEQDLTAENMEDFCNEISILSRLRHPNVILFL 614

  Fly   490 G-CVSKPSLAIVTQWCEGSSLYKHVHVSETKFKLN--TLIDIGRQVAQGMDYLHAKNIIHRDLKS 551
            | |...|.|:::|::.|..|||..:|:|..|.:|:  ..:.:.|.:.:|:..:|...|:|||:||
plant   615 GACTKPPRLSLITEYMEMGSLYYLLHLSGQKKRLSWRRKLKMLRDICRGLMCIHRMGIVHRDIKS 679

  Fly   552 NNIFLHEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAFGI 616
            .|..|....:|||.||||:...|..:.....:  .|:..|||||:||.:   |:|.:.|:::.|:
plant   680 ANCLLSNKWTVKICDFGLSRIMTGTTMRDTVS--AGTPEWMAPELIRNE---PFSEKCDIFSLGV 739

  Fly   617 VMYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQA-LKRLAEDCIKYT-PKDRPLF 679
            :|:||.....|:..:..:..:..:...|        .|.:.|:. |.:|..||  :| |:.||..
plant   740 IMWELCTLTRPWEGVPPERVVYAIAYEG--------ARLEIPEGPLGKLIADC--WTEPEQRPSC 794

  Fly   680 RPLLNML 686
            ..:|:.|
plant   795 NEILSRL 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514 8/69 (12%)
C1_Raf 221..269 CDD:410361 4/47 (9%)
STKc_Raf 435..687 CDD:270964 81/258 (31%)
AT3G58640NP_567072.1 EDR1 56..249 CDD:405130
STKc_MAP3K-like 559..801 CDD:270901 80/256 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.