DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and AT3G01490

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_186798.1 Gene:AT3G01490 / 821136 AraportID:AT3G01490 Length:411 Species:Arabidopsis thaliana


Alignment Length:374 Identity:106/374 - (28%)
Similarity:183/374 - (48%) Gaps:50/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 NIRSVTSEVQRSL----IMQARPPLPHPCTDHSNSTQASPTS----TLKHNRPRA----RSADES 406
            :::|:..::||.|    .|:.|..|... .|:.|:|:.:..:    .|...||..    .:.:.|
plant    20 DLKSLDEQLQRHLSKAWTMEKRKSLSDG-EDNVNNTRHNQNNFGHRQLVFQRPLLGGGYSNNNNS 83

  Fly   407 NKNLLLR--DAKSSEENWNILAEEILIGPRIGSGSFGTVYRAHWHG-PVAVKTLNVKTP---SPA 465
            :||.::|  :.:.|...|.|...:::|...|..|:||||:|..:.| .||||.|:....   |.|
plant    84 SKNDIIRSTEVEKSRREWEIDPSKLIIKSVIARGTFGTVHRGIYDGQDVAVKLLDWGEEGHRSDA 148

  Fly   466 QL----QAFKNEVAMLKKTRHCNILLFMGC---------------VSKPS--LAIVTQWCEGSSL 509
            ::    .||..|||:..|..|.|:..|:|.               :..||  ..:|.::|.|.:|
plant   149 EIASLRAAFTQEVAVWHKLDHPNVTKFIGAAMGTSEMSIQTENGQMGMPSNVCCVVVEYCPGGAL 213

  Fly   510 YKH-VHVSETKFKLNTLIDIGRQVAQGMDYLHAKNIIHRDLKSNNIFLHEDLSVKIGDFGLATAK 573
            ... :.....|.....:|.:...:|:|:.|||::.|:|||:|:.|:.|.:..::||.|||:|..:
plant   214 KSFLIKTRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVARLE 278

  Fly   574 TRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAFGIVMYELLAECLPYGHISNKDQIL 638
            .  |........||::.:|||||:..   :||:.:.|||:|||.::|:....:||..:| ..::.
plant   279 A--SNPNDMTGETGTLGYMAPEVLNG---SPYNRKCDVYSFGICLWEIYCCDMPYPDLS-FSEVT 337

  Fly   639 FMVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTPKDRPLFRPLLNMLE 687
            ..|.|..|||::.:.   .|.:|..:.:.|....|:.||....::.|||
plant   338 SAVVRQNLRPEIPRC---CPSSLANVMKRCWDANPEKRPEMEEVVAMLE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 83/277 (30%)
AT3G01490NP_186798.1 STKc_MAP3K-like 114..382 CDD:270901 82/276 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.