DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and AT2G43850

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_181913.3 Gene:AT2G43850 / 818989 AraportID:AT2G43850 Length:479 Species:Arabidopsis thaliana


Alignment Length:450 Identity:120/450 - (26%)
Similarity:193/450 - (42%) Gaps:69/450 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 RGTAVRFN---MSSRSRSRRCSSSGSSSSSKPPSS---------------SSGNHR-------QG 333
            |.|.:||:   .||....|| |...|.|..:|..|               |.|:.|       :|
plant    38 RRTNMRFSFGRQSSLDPIRR-SPDSSKSDDEPHMSVPENLDSTMQLLFMASKGDVRGIEELLDEG 101

  Fly   334 RPPR-ISQDDRSNSAPNVCINNIRSVTSEVQRSLIMQARPPLPHPCTDHSNSTQASPTSTL---- 393
            .... |..|.|:......|..::..|.:.:.|...:.||        |...||.|:.....    
plant   102 IDVNSIDLDGRTALHIAACEGHLGVVKALLSRRANIDAR--------DRWGSTAAADAKYYGNLD 158

  Fly   394 KHNRPRARSA--DESNKN--LLLRDAKSSEENWNILAEEILIGPRIGSGSFGTVYRAHWHGP-VA 453
            .:|..:||.|  .::.|.  .:....:..|...|.|..::.....|..|::..   |.|:|. |:
plant   159 VYNLLKARGAKVPKTRKTPMTVSNPREVPEYELNPLEVQVRKSDGISKGAYQV---AKWNGTRVS 220

  Fly   454 VKTLNVKTPS-PAQLQAFKNEVAMLKKTRHCNILLFMGCVSK--PSLAIVTQWCEGS-SLY--KH 512
            ||.|:..:.| |.::.||::|:.:|:|.||.|::.|:|.|::  |.:.:|....:|. |:|  |.
plant   221 VKILDKDSYSDPERINAFRHELTLLEKVRHPNVIQFVGAVTQNIPMMIVVEYNPKGDLSVYLQKK 285

  Fly   513 VHVSETKFKLNTLIDIGRQVAQGMDYLH---AKNIIHRDLKSNNIFLHEDLSVKIGDFG-LATAK 573
            ..:|.:| .|...:||    |:||:|||   ...|||.|||..||.|.....:||..|| :..:|
plant   286 GRLSPSK-ALRFALDI----ARGMNYLHECKPDPIIHCDLKPKNILLDRGGQLKISGFGMIRLSK 345

  Fly   574 TRWSGEKQANQPTG---SILWMAPEVIRMQELNPYSFQSDVYAFGIVMYELLAECLPYGHISNKD 635
            ......|.||....   |..::||||.: .|:  :..:.|.::||:::|| :.|.:|..|....:
plant   346 ISQDKAKVANHKAHIDLSNYYIAPEVYK-DEI--FDLRVDAHSFGVILYE-ITEGVPVFHPRPPE 406

  Fly   636 QILFMVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTPKDRPLFRPLLNMLENMLRTLPK 695
            ::..|:.....||.........|..:|.|.|.|.......||.|..::..|:.::....|
plant   407 EVARMMCLEGKRPVFKTKSRSYPPDIKELIEKCWHPEAGIRPTFSEIIIRLDKIVANCSK 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 81/265 (31%)
AT2G43850NP_181913.3 Ank_2 82..170 CDD:372319 20/95 (21%)
ANK repeat 82..108 CDD:293786 4/25 (16%)
ANK repeat 110..141 CDD:293786 7/38 (18%)
ANK repeat 143..168 CDD:293786 6/24 (25%)
PKc_like 204..457 CDD:389743 81/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.