DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and STY8

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_179361.1 Gene:STY8 / 816278 AraportID:AT2G17700 Length:546 Species:Arabidopsis thaliana


Alignment Length:317 Identity:108/317 - (34%)
Similarity:171/317 - (53%) Gaps:24/317 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 DHSNSTQASPTSTLKHNRPRARSADESNKNLL---LRDAKSSEENWNILAEEILIGPRIGSGSFG 441
            |...|.|.| .|..:|        |:|:..|:   :.......:.|.|...::.|..::.|||:|
plant   243 DQPGSKQKS-ISFFEH--------DKSSNELIPACIEIPTDGTDEWEIDVTQLKIEKKVASGSYG 298

  Fly   442 TVYR-AHWHGPVAVKTLNVKTPSPAQLQAFKNEVAMLKKTRHCNILLFMG-CVSKPSLAIVTQWC 504
            .::| .:....||:|.|.....:...|:.|..||.:::|.||.|::.|:| |...|:|.|||::.
plant   299 DLHRGTYCSQEVAIKFLKPDRVNNEMLREFSQEVFIMRKVRHKNVVQFLGACTRSPTLCIVTEFM 363

  Fly   505 EGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLHAKNIIHRDLKSNNIFLHEDLSVKIGDFGL 569
            ...|:|..:|..:..|||.||:.:...||:||.|||..||||||||:.|:.:.|...||:.|||:
plant   364 ARGSIYDFLHKQKCAFKLQTLLKVALDVAKGMSYLHQNNIIHRDLKTANLLMDEHGLVKVADFGV 428

  Fly   570 ATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAFGIVMYELLAECLPYGHISNK 634
            |..:.. ||...|.  ||:..|||||||   |..||:.::||:::.||::|||...:||..::..
plant   429 ARVQIE-SGVMTAE--TGTYRWMAPEVI---EHKPYNHKADVFSYAIVLWELLTGDIPYAFLTPL 487

  Fly   635 DQILFMVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTPKDRPLFRPLLNMLENMLR 691
            ...:.:|.:| |||   ::.......:|.|.|.|....|:.||||..::.||:.:::
plant   488 QAAVGVVQKG-LRP---KIPKKTHPKVKGLLERCWHQDPEQRPLFEEIIEMLQQIMK 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 95/253 (38%)
STY8NP_179361.1 ACT_TyrKc 172..239 CDD:153200
Pkinase_Tyr 286..535 CDD:285015 95/258 (37%)
STKc_MAP3K-like 292..535 CDD:270901 94/252 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.