DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and si:ch211-45c16.2

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:XP_017213349.1 Gene:si:ch211-45c16.2 / 568412 ZFINID:ZDB-GENE-081105-15 Length:982 Species:Danio rerio


Alignment Length:274 Identity:90/274 - (32%)
Similarity:139/274 - (50%) Gaps:30/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 ENWNILAEEILIGPRIGSGSFGTVYRAHWHG-PVAVKTLNVKTPSPAQLQAFKNEVAMLKKTRHC 483
            |.|.:..|||.....:|||:.|.|:...:.. .||:|.:.         :..:.::..|:|.:|.
Zfish   211 EMWEVPFEEISELQWLGSGAQGAVFLGKFRSEEVAIKKVR---------EQKETDIKHLRKLKHP 266

  Fly   484 NILLFMG-CVSKPSLAIVTQWCEGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLHAKNIIHR 547
            ||:.|.| |...|...|:.::|....||:.:.... |.....|:|....:|.||:|||...||||
Zfish   267 NIISFKGVCTQAPCYCIIMEYCAQGQLYEVLRAGR-KITPCLLVDWASGIASGMNYLHLHKIIHR 330

  Fly   548 DLKSNNIFLHEDLSVKIGDFG----LATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQ 608
            ||||.|:.:.::.||||.|||    |:...|:.|.       .|::.||||||||.:   |.|.:
Zfish   331 DLKSPNVLVTQNDSVKISDFGTSKELSDKSTKMSF-------AGTVAWMAPEVIRNE---PVSEK 385

  Fly   609 SDVYAFGIVMYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTP 673
            .|:::||:|::|||...:||..: :...|::.||...|.   ..|.|..|...|.|.:...:..|
Zfish   386 VDIWSFGVVLWELLTGEIPYKDV-DSSAIIWGVGSNSLH---LPVPSTCPDGFKILMKQTWQGKP 446

  Fly   674 KDRPLFRPLLNMLE 687
            ::||.||.:|..|:
Zfish   447 RNRPSFRQILLHLD 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 84/257 (33%)
si:ch211-45c16.2XP_017213349.1 STKc_MAP3K12_13 226..462 CDD:270961 85/259 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.