DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and Ilk

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster


Alignment Length:265 Identity:71/265 - (26%)
Similarity:126/265 - (47%) Gaps:34/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 GTVYRAHWH-GPVAVKTLNVKTPSPAQLQAFKNEVAMLKKTRHCNILLFMG-CVSKPSLAIVTQW 503
            |..:|..|. ..|..|.|.|:..:|...:.|..|...|:...|.|||..:| |.|.|:|..::|:
  Fly   204 GETWRGRWQKNDVVAKILAVRQCTPRISRDFNEEFPKLRIFSHPNILPIIGACNSPPNLVTISQF 268

  Fly   504 CEGSSLYKHVH-----VSETKFKLNTLIDIGRQVAQGMDYLHA-KNII---HRDLKSNNIFLHED 559
            ...|||:..:|     |.:|...::..:|    ||:||.:||: :.||   |  |.|:::.:.:|
  Fly   269 MPRSSLFSLLHGATGVVVDTSQAVSFALD----VARGMAFLHSLERIIPTYH--LNSHHVMIDDD 327

  Fly   560 LSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAFGIVMYELLAE 624
            |:.:|   .:..||..:..:.:..||.    ||:||.::.::.:......|:::|.|:::||...
  Fly   328 LTARI---NMGDAKFSFQEKGRIYQPA----WMSPETLQRKQADRNWEACDMWSFAILIWELTTR 385

  Fly   625 CLPYGHISNKDQILFMVGRGL---LRPDMSQVRSDAPQALKRLAEDCIKYTPKDRPLFRPLLNML 686
            .:|:...|..:..:.:...||   :.|..|       ..:.:|...|:...|..||.|..::.:|
  Fly   386 EVPFAEWSPMECGMKIALEGLRVKIPPGTS-------THMAKLISICMNEDPGKRPKFDMVVPIL 443

  Fly   687 ENMLR 691
            |.|.|
  Fly   444 EKMRR 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 67/259 (26%)
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 69/261 (26%)
STYKc 204..443 CDD:214568 67/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.