DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and slpr

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster


Alignment Length:312 Identity:89/312 - (28%)
Similarity:144/312 - (46%) Gaps:40/312 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 PRARSADES----NKNLLLRDAKSSEENWNILAEEILIGPRIGSGSFGTVYRAHWHG-PVAVKTL 457
            |:....||.    |.:..:.|.:..|..:|    |:.|...||||.|..|:|.::.| .||:|..
  Fly    98 PKDFVTDEDPLQLNVSSAIGDIQPHEIEYN----ELDIKEVIGSGGFCKVHRGYYDGEEVAIKIA 158

  Fly   458 NVKTPSPAQLQAFKNEVAMLKK----TRHCNILLFMGCVSKPSLAIVTQWCEGSSLYKHVHVSET 518
            :  ......:|..::.|....|    .:|.||....|......|.:|.::..|.||.:   :...
  Fly   159 H--QTGEDDMQRMRDNVLQEAKLFWALKHENIAALRGVCLNTKLCLVMEYARGGSLNR---ILAG 218

  Fly   519 KFKLNTLIDIGRQVAQGMDYLHAK---NIIHRDLKSNNIFLHEDL--------SVKIGDFGLATA 572
            |...:.|::...|:|:||:|||.:   :||||||||:|:.::|.:        ::||.|||||  
  Fly   219 KIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLA-- 281

  Fly   573 KTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAFGIVMYELLAECLPYGHISNKDQI 637
              |.....|.....|:..||.||||   .::.||..|||:::|::::||:....||.........
  Fly   282 --REMYNTQRMSAAGTYAWMPPEVI---SVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVA 341

  Fly   638 LFMVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTPKDRPLFRPLLNMLENM 689
            ..:....|..|    :....|:....|.:.|.:..|..||.|:.:|..||::
  Fly   342 YGVAVNTLTLP----IPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESI 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 78/267 (29%)
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 1/5 (20%)
TyrKc 129..386 CDD:197581 79/272 (29%)
STKc_MLK 134..389 CDD:270963 80/270 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445242
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.