DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and Takl2

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster


Alignment Length:239 Identity:67/239 - (28%)
Similarity:114/239 - (47%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 EEILIGPRIGSGSFGTVYRAHWHG-PVAVKTLNVKTPSPAQLQAFKNEVAMLKKTRHCNILLFMG 490
            |||.....||:|.:|:||||.|.. .:|:|.:.    ...:.:..:.|:..|.|..|.||:...|
  Fly    11 EEIQTKELIGTGFYGSVYRAVWRNREIALKRIR----EGCEDKKIEREIYQLTKASHVNIVELYG 71

  Fly   491 CVSKPSLA-IVTQWCEGSSLYKHVHV-SETKFKLNTLIDIGRQVAQGMDYLHA---KNIIHRDLK 550
            .......| ::.::.:|.||...:|. |:..:......:...|:|||:.|||.   |.:||||:|
  Fly    72 TSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIK 136

  Fly   551 S-NNIFLHEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAF 614
            . |.:...:.|.:||.|||.....:     :..:...|:..:.||||:   :.|....:.|||::
  Fly   137 PLNTLLCEKGLKLKICDFGTVVDLS-----QSISCNAGTCRYKAPEVL---QGNKPDEKCDVYSW 193

  Fly   615 GIVMYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAP 658
            .|..:|:|:...|:...:...::...:..| .|||:|.:.|..|
  Fly   194 AITFWEILSRKEPFEQYNTLFELYMAINEG-ERPDLSCIMSGCP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 64/231 (28%)
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 64/236 (27%)
PKc_like 19..268 CDD:304357 64/231 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.