DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and Mos

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster


Alignment Length:234 Identity:62/234 - (26%)
Similarity:102/234 - (43%) Gaps:30/234 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 IGSGSFGTVYRAHWHG-PVAVKTLNVKTPSPAQLQAFKNEVAMLKKTRHCNILLFMGCVSKPSLA 498
            :|.|::|||::|.:.. .||||.:..:..|     ...||..:| ...|.||:..:...|.....
  Fly    28 LGRGAYGTVFKAIYRDRSVAVKIIRAQAAS-----TLHNESHLL-NLEHRNIVRLLKLESAADFG 86

  Fly   499 IVTQWC-EGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLHAKNIIHRDLKSNNIF------- 555
            :|...| .|.||.:.|...........||.:  .|...:.|.|::|::|.|:|..||.       
  Fly    87 LVIMECPRGQSLQRIVDTLALPLMHRVLITL--DVVAALRYCHSQNVLHLDVKPTNILVALGTKS 149

  Fly   556 ----------LHEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSD 610
                      :......|:.|||.:.....:...::.:...|::.:|:||.:|...|..   .||
  Fly   150 SITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVAKGTLRYMSPEALRSDTLTE---ASD 211

  Fly   611 VYAFGIVMYELLAECLPYGHISNKDQILFMVGRGLLRPD 649
            :|:.||.|::|.|..|||..:...:.|.:.|.:..||||
  Fly   212 IYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 62/234 (26%)
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 62/234 (26%)
S_TKc 26..257 CDD:214567 62/234 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.