DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and Ripk1

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001100820.1 Gene:Ripk1 / 306886 RGDID:1310158 Length:658 Species:Rattus norvegicus


Alignment Length:343 Identity:98/343 - (28%)
Similarity:170/343 - (49%) Gaps:48/343 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 SEENWNILAEEILIGPRIGSGSFGTV----YRAHWHGPVAVKTLNVKT-PSPAQL-QAFKNEVAM 476
            |.:|..:.::::|....:.||.||.|    :|.  ||.|.:|  .|.| |:.|:. :|...|..|
  Rat     6 SLDNIKMASDDLLERKDLDSGGFGKVSLCFHRT--HGFVILK--KVYTGPNRAEYNEALLEEGKM 66

  Fly   477 LKKTRHCNILLFMG-CVSKPSLAIVTQWCEGSSLYKHVHVSETKFKLNTLIDIGR---QVAQGMD 537
            :.:.||..::..:| .:.:.:.::|.::.|..:|   :||.:||..:...:. ||   ::.:||.
  Rat    67 MHRLRHDRVVKLLGIIIEEGNYSLVMEYMEQGNL---MHVLKTKESVPLSVK-GRIIVEIIEGMH 127

  Fly   538 YLHAKNIIHRDLKSNNIFLHEDLSVKIGDFGLATAKTRWS--------GEKQANQPT----GSIL 590
            |||.:.:||:|||..||.:..|..:||.|.|:|:.|| ||        .:::|:..|    |::.
  Rat   128 YLHDEGVIHKDLKPENILVDRDFHIKIADLGVASFKT-WSKLTKEEHNKQREASSVTKKNGGTLY 191

  Fly   591 WMAPEVIRMQELNPYSFQSDVYAFGIVMYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRS 655
            :||||.:......| :.:||||:|.||::.:.|...||.::...:|.|..:..| .||::..:..
  Rat   192 YMAPEHLTDINTKP-TEKSDVYSFAIVLWAIFANKEPYENVICTEQFLVCINSG-NRPNVEDILE 254

  Fly   656 DAPQALKRLAEDCIKYTPKDRPL-------FRPLL-----NMLENMLRTLPKIHRSASEPNLTQS 708
            ..|:.:..|.|.|.:..|:|||.       |:|..     ..:|..:.:|.|.:.|.|.......
  Rat   255 FCPREIISLMERCWQTNPEDRPTFFGIEKEFKPFYLSQFEEYVEEDVASLKKEYPSQSPVLKRMF 319

  Fly   709 QLQNDEFLYLPSPKTPVN 726
            .||:|   .:|.|.:..|
  Rat   320 SLQHD---CVPLPPSRSN 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 84/285 (29%)
Ripk1NP_001100820.1 PKc_like 23..290 CDD:419665 84/277 (30%)
Death_RIP1 570..655 CDD:260048
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.