DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and Tesk2

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:XP_030109303.1 Gene:Tesk2 / 230661 MGIID:2385204 Length:650 Species:Mus musculus


Alignment Length:304 Identity:88/304 - (28%)
Similarity:137/304 - (45%) Gaps:43/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 RIGSGSFGTVYRAHWHGPVAVKTLNVKTPSPAQLQAFKNEVAMLKKTRHCNILLFMG-CVSKPSL 497
            :||||.|..|::........|..|.:.|.|..:....| |:.::.:..|.|||.||| ||.:..|
Mouse   143 KIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANLLK-EMQLMNRLSHPNILRFMGVCVHQGQL 206

  Fly   498 AIVTQWCEGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLHAKNIIHRDLKSNNIFLHED--- 559
            ..:|::....:| :.:..|:........:.:...:|.|:.|||.|.|.||||.|.|..:..|   
Mouse   207 HALTEYINSGNL-EQLLDSDLYLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSKNCLIKRDENG 270

  Fly   560 LSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAFGIVMYELLA- 623
            .|..:.|||||......|..::.....||..||||||:|.:   ||:.::||:::||::.|::| 
Mouse   271 YSAVVADFGLAEKIPDASIGREKLAVVGSPFWMAPEVLRDE---PYNEKADVFSYGIILCEIIAR 332

  Fly   624 -----ECLPYGHISNKDQILF--MVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTPKDRPLFRP 681
                 :.||.......|...|  |||             |.|....:|..:|....||.||.|..
Mouse   333 IQADPDYLPRTENFGLDYDAFQNMVG-------------DCPSDFLQLTFNCCNMDPKLRPSFEE 384

  Fly   682 LLNMLENMLRTLPKIHRSASEPNLTQSQLQNDEFLYLPSPKTPV 725
            :...|:.::..||            :.:|:.|..|. |:.|.|:
Mouse   385 IGKTLKEIMSRLP------------EEELERDRKLQ-PTAKGPL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 79/263 (30%)
Tesk2XP_030109303.1 PKc_TESK 144..396 CDD:271057 80/269 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.