DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and F22B3.8

DIOPT Version :9

Sequence 1:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_502160.4 Gene:F22B3.8 / 184809 WormBaseID:WBGene00009039 Length:497 Species:Caenorhabditis elegans


Alignment Length:318 Identity:94/318 - (29%)
Similarity:149/318 - (46%) Gaps:63/318 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 ENWNILAEEILIGP-RIGSGSFGTVYRAHWHGP-------------VAVKTLNVKTPSPAQLQAF 470
            ::|.:.||.|.:.| ::|.|:||.||...|..|             |||||:. ...|.|.|...
 Worm   202 QDWELRAEGIDMTPKKLGEGAFGIVYLGRWAQPFSVDQKEFHKWCDVAVKTVK-NDDSRAALLEV 265

  Fly   471 KNEVAMLKKTRHCNILLFMG--CVSKPSLAIVTQWCEGSSLYKHVHVSE-TKFKLNTLIDIGRQV 532
            .:|..:..:.||.|:|.|.|  .:.|| :.:|:::||.......|.|.| .:|.|.:        
 Worm   266 MHEARLQLQLRHKNVLAFRGVFLLKKP-IMLVSEFCENYLQKSKVSVDEKLRFCLGS-------- 321

  Fly   533 AQGMDYLHAKNIIHRDLKSNNIFLHEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVI 597
            :.|::|:|.|.:|||||.:.||.:..|.:.||.|||||...:.:...|....|   :.::|||.:
 Worm   322 SCGLEYIHFKGLIHRDLATRNILVSADKTPKIADFGLAKHASSYKMRKATKIP---VRYLAPETL 383

  Fly   598 RMQELNPYSFQSDVYAFGIVMYELLA-------------ECLPYGHISNKDQILFMVGRG----- 644
               ....||.::|||.||:|::|:.|             ||     ::.|:..|    ||     
 Worm   384 ---SSFVYSTKTDVYTFGLVIWEIFANGQEPYMKAQPHQEC-----VAPKNTQL----RGRHIKE 436

  Fly   645 LLRPDM-SQVRSDAPQALKR-LAEDCIKYTPKDRPLFRPLLNMLENMLRT-LPKIHRS 699
            |:|.:: .:...:||.||:: :|........|.||....:...|.:||:. |.|:..|
 Worm   437 LIRKELFVKFNQEAPVALQQYVAAKLFVVDDKKRPDMPEVSTFLGDMLKVDLTKMRYS 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 83/287 (29%)
F22B3.8NP_502160.4 SH2 64..186 CDD:214585
S_TKc 216..476 CDD:214567 83/284 (29%)
PTKc 216..>412 CDD:270623 67/211 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.