DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Raf and FPGT-TNNI3K

DIOPT Version :10

Sequence 1:NP_525047.1 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001106279.3 Gene:FPGT-TNNI3K / 100526835 HGNCID:42952 Length:936 Species:Homo sapiens


Alignment Length:359 Identity:103/359 - (28%)
Similarity:168/359 - (46%) Gaps:28/359 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 RPPLPHPCTDHSNS-------TQASPTSTLKHNRPRARSADESNKNLLLRDAKSSEENWNILAEE 428
            ||....||.::|..       :..||...:|      ....|....||||....|  ::::...|
Human   507 RPQDELPCNEYSQPGGDGSYVSVPSPLGKIK------SMTKEKADILLLRAGLPS--HFHLQLSE 563

  Fly   429 ILIGPRIGSGSFGTVYRAHWHGP-VAVKTLNVKT-PSPAQLQAFKNEVAMLKKTRHCNILLFMG- 490
            |.....|||||||.||:...... ||:|.....| .|.:.:..|..||::|.:..|..::.|:| 
Human   564 IEFHEIIGSGSFGKVYKGRCRNKIVAIKRYRANTYCSKSDVDMFCREVSILCQLNHPCVIQFVGA 628

  Fly   491 CVSKPS-LAIVTQWCEGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLH--AKNIIHRDLKSN 552
            |::.|| .|||||:..|.||:..:|..:....|.:.:.|...||:||:|||  .:.||||||.|:
Human   629 CLNDPSQFAIVTQYISGGSLFSLLHEQKRILDLQSKLIIAVDVAKGMEYLHNLTQPIIHRDLNSH 693

  Fly   553 NIFLHEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAFGIV 617
            ||.|:||....:.|||.:........:....|| |::.||||||  ..:...|:.::||:::.:.
Human   694 NILLYEDGHAVVADFGESRFLQSLDEDNMTKQP-GNLRWMAPEV--FTQCTRYTIKADVFSYALC 755

  Fly   618 MYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTPKDRPLFRPL 682
            ::|:|...:|:.|:........|....:..|    :....|:.:..|........|:.||.|..:
Human   756 LWEILTGEIPFAHLKPAAAAADMAYHHIRPP----IGYSIPKPISSLLIRGWNACPEGRPEFSEV 816

  Fly   683 LNMLENMLRTLPKIHRSASEPNLTQSQLQNDEFL 716
            :..||..|..:..:..::|..:.:.|...:.:.|
Human   817 VMKLEECLCNIELMSPASSNSSGSLSPSSSSDCL 850

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RafNP_525047.1 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 81/257 (32%)
FPGT-TNNI3KNP_001106279.3 ANKYR 155..391 CDD:440430
ANK repeat 167..199 CDD:293786
ANK repeat 201..232 CDD:293786
ANK repeat 235..265 CDD:293786
ANK repeat 267..298 CDD:293786
ANK repeat 300..333 CDD:293786
ANK repeat 335..363 CDD:293786
ANK repeat 370..403 CDD:293786
ANK repeat 405..438 CDD:293786
Ank_2 410..502 CDD:463710
ANK repeat 440..470 CDD:293786
PKc_TNNI3K 570..823 CDD:270966 83/259 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.