DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp6 and Ilp3

DIOPT Version :9

Sequence 1:NP_001188538.1 Gene:Ilp6 / 31220 FlyBaseID:FBgn0044047 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_648360.2 Gene:Ilp3 / 39151 FlyBaseID:FBgn0044050 Length:120 Species:Drosophila melanogaster


Alignment Length:86 Identity:25/86 - (29%)
Similarity:31/86 - (36%) Gaps:31/86 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MCSTGLSDVIQKICVSGTVA--------------------------LGDVFPNSFGKRRKRDLQN 85
            :|...|.:.:.|:||.|..|                          |.|........||.||  .
  Fly    33 LCGRKLPETLSKLCVYGFNAMTKRTLDPVNFNQIDGFEDRSLLERLLSDSSVQMLKTRRLRD--G 95

  Fly    86 VTDLCC-KSGGCTYRELLQYC 105
            |.|.|| ||  ||..|:|:||
  Fly    96 VFDECCLKS--CTMDEVLRYC 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp6NP_001188538.1 IlGF_like <78..105 CDD:295312 14/27 (52%)
Ilp3NP_648360.2 IlGF_insulin_bombyxin_like 33..114 CDD:239832 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D160688at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.