DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp6 and IGF2

DIOPT Version :9

Sequence 1:NP_001188538.1 Gene:Ilp6 / 31220 FlyBaseID:FBgn0044047 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001121070.1 Gene:IGF2 / 3481 HGNCID:5466 Length:236 Species:Homo sapiens


Alignment Length:106 Identity:31/106 - (29%)
Similarity:41/106 - (38%) Gaps:29/106 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VPTSKVLLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCSTGLSDVIQKICVSGTVALGD 69
            :|..|.:|||.|..|.|:..      :||       |.....:|...|.|.:|.:|       ||
Human    59 IPMGKSMLVLLTFLAFASCC------IAA-------YRPSETLCGGELVDTLQFVC-------GD 103

  Fly    70 ---VF--PNSFGKRRKRDLQNVTDLCCKSGGCTYRELLQYC 105
               .|  |.|...||.|.:  |.:.|.:|  |....|..||
Human   104 RGFYFSRPASRVSRRSRGI--VEECCFRS--CDLALLETYC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp6NP_001188538.1 IlGF_like <78..105 CDD:295312 8/26 (31%)
IGF2NP_001121070.1 nt_trans <4..51 CDD:320711
IlGF 84..147 CDD:239834 20/68 (29%)
IGF2_C 168..222 CDD:285554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.