powered by:
Protein Alignment Ilp6 and igf2b
DIOPT Version :9
Sequence 1: | NP_001188538.1 |
Gene: | Ilp6 / 31220 |
FlyBaseID: | FBgn0044047 |
Length: | 107 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001001815.1 |
Gene: | igf2b / 324215 |
ZFINID: | ZDB-GENE-030131-2935 |
Length: | 212 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 20/72 - (27%) |
Similarity: | 28/72 - (38%) |
Gaps: | 7/72 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 LAPTEYEQRRMMCSTGLSDVIQKICVSGTVALGDVF--PNSFGKRRKRDLQNVTDLCCKSGGCTY 98
|:..|......:|...|.|.:|.:|.. .|..| |.|....|:...:.:.:.||.| .|..
Zfish 42 LSAFEVASAETLCGGELVDALQFVCED----RGFYFSRPTSRSNSRRSQNRGIVEECCFS-SCNL 101
Fly 99 RELLQYC 105
..|.|||
Zfish 102 ALLEQYC 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1644517at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.