DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2865 and sertad4

DIOPT Version :9

Sequence 1:NP_001259184.1 Gene:CG2865 / 31217 FlyBaseID:FBgn0023526 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_001337771.2 Gene:sertad4 / 797299 ZFINID:ZDB-GENE-090313-199 Length:338 Species:Danio rerio


Alignment Length:221 Identity:53/221 - (23%)
Similarity:77/221 - (34%) Gaps:51/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ISPKLRQREERKRILQLCAHKMERIKDSEANLRRSVCINNTYCRLNDELRREKQMRYLQNLPRTS 124
            :||.|   |||..||:|...|:..:.|.|:.|||||.|||...||.:|:..:....:... |.|:
Zfish    96 VSPVL---EERAHILRLSLEKLRFMDDPESFLRRSVLINNLLRRLRNEILLQSDWCFPSG-PTTT 156

  Fly   125 DSGASTELARENLFQPNMDDA-KPAGNST----------------------------------SN 154
            .....|..|..:|..|.:... .|.|:..                                  ..
Zfish   157 PCPLQTPAANTSLSPPALQPCITPPGSYRKRLRLMRKEGPECVPACCCLYAAGRYLQLPLSVYER 221

  Fly   155 NINANGKPSSSFGDAFGSSNGSSSGRGGICSLENQPPERQQLGTPAGASAPEAANSAPLSVSGSA 219
            .:.:|..||||   ...||:.|||.|.         |:..:......:...|..:..|:.....|
Zfish   222 EVYSNSHPSSS---TSSSSSSSSSVRF---------PQLMEDEDEEDSDDEEEDSVCPVLAMCQA 274

  Fly   220 SERVNNRKRHLSSCNLVNDLEILDRE 245
            ..|..||...........|.:||::|
Zfish   275 ETREQNRTWDSLRSQSHRDDKILEKE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2865NP_001259184.1 SERTA 73..109 CDD:283648 17/35 (49%)
sertad4XP_001337771.2 SERTA 106..141 CDD:283648 16/34 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594983
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E2MX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.