DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2865 and Sertad4

DIOPT Version :9

Sequence 1:NP_001259184.1 Gene:CG2865 / 31217 FlyBaseID:FBgn0023526 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001101821.1 Gene:Sertad4 / 360899 RGDID:1565408 Length:366 Species:Rattus norvegicus


Alignment Length:336 Identity:74/336 - (22%)
Similarity:119/336 - (35%) Gaps:108/336 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DSDMFGPPRCSPP-----------------IGYHHHRSRVPMISPKL---RQR------------ 67
            ::|.:|  ..|||                 .|.|:.....|:.:||:   :::            
  Rat    30 EADSYG--GASPPGPAHVPSQGDRGAGPQLAGSHYRGISNPVSTPKVTYFKRKYAEEEELPTPLS 92

  Fly    68 ----------EERKRILQLCAHKMERIKDSEANLRRSVCINNTYCRLNDELRREKQMRYLQN--- 119
                      |||..||.:...|:..|.|.|..|||||.|||...|::.|:       .:||   
  Rat    93 SCSHKTISIFEERAHILYMSLEKLRFIDDPEVYLRRSVLINNLMKRIHGEI-------VMQNSWY 150

  Fly   120 LPRTSDSGASTE---LARENLFQPNMDDAK-------------PAGNSTSNNINANGKPSSSFGD 168
            ||..|.||.|.:   ||::..::.....||             ..|....|       ...|..|
  Rat   151 LPACSLSGTSAQEWFLAQDCPYRKRPRVAKQEWEKFHTCCFYQECGGHCLN-------LPLSVSD 208

  Fly   169 AFGSSNGSSSGRGGICSLENQPPERQQLGTPAGASAPEAANSAPLSVSGSASERVNNRKRHLSSC 233
            ..||::.::                  :.:||.:|: ..:.|:|.|.|.|:|..  :....|.||
  Rat   209 GVGSASAAA------------------VASPASSSS-SPSTSSPSSPSSSSSSL--SSPLPLPSC 252

  Fly   234 NLVNDLEILDREL--SAINAPMLLIDPEITQGAEQLEKAALSASRKRLRSNS------GSEDESD 290
            :...|.::....:  |.:.|..:.:....:.|.:  ||...::..|.....|      |.|...:
  Rat   253 SHHVDFDVGSAPIYKSQVPASEIFVTNVRSLGVQ--EKIKFNSDGKVSHETSRDGNALGQEPVGN 315

  Fly   291 RLVREALSQFY 301
            .|..|...|||
  Rat   316 DLDFECKGQFY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2865NP_001259184.1 SERTA 73..109 CDD:283648 16/35 (46%)
Sertad4NP_001101821.1 SERTA 108..142 CDD:399196 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353005
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.