DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2918 and yegD

DIOPT Version :9

Sequence 1:NP_001162645.1 Gene:CG2918 / 31215 FlyBaseID:FBgn0023529 Length:923 Species:Drosophila melanogaster
Sequence 2:NP_416573.4 Gene:yegD / 947234 ECOCYCID:EG12200 Length:450 Species:Escherichia coli


Alignment Length:445 Identity:90/445 - (20%)
Similarity:164/445 - (36%) Gaps:110/445 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DLGSEWMKVGVVSPGVPMEIALNRESKRKTPAIL-------------------AFRDGTRTIGED 71
            |.|:....|.|:..|.|..:.:..:| ...|::|                   |..|.|:.:...
E. coli     6 DYGTANCSVAVMRDGKPHLLKMENDS-TLLPSMLCAPTREAVSEWLYRHHDVPADDDETQALLRR 69

  Fly    72 A------QTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFP--YYNIVGDPERNTVVFRKSDT 128
            |      :.|.:...:..:|  |..|.:.||:| .:::..:.|  :....|...:...:|     
E. coli    70 AIRYNREEDIDVTAKSVQFG--LSSLAQYIDDP-EEVWFVKSPKSFLGASGLKPQQVALF----- 126

  Fly   129 DEFSVEELVAQLLVKAKQFAQESVQQPITECVLTVPGYF-----GQAEREA---LLSAAQLANLK 185
                 |:||..:::..:|.||..:.:.||:.|:..|..|     .:|..:|   |..||:.|..:
E. coli   127 -----EDLVCAMMLHIRQQAQAQLPEAITQAVIGRPINFQGLGGDEANTQAQGILERAAKRAGFR 186

  Fly   186 VLQLINDYAAVALNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDKQTRE-------- 242
              .::..|..||.  |:.:...:.|..: .|..|:|...|..::    |:...|.|.        
E. coli   187 --DVVFQYEPVAA--GLDYEATLQEEKR-VLVVDIGGGTTDCSL----LLMGPQWRSRLDREASL 242

  Fly   243 ------------------INPVVQVLGVGYDRTLG-GLEI-----QLRLRDYLAQ-EF--NALKK 280
                              ...::.:||:|.:...| .|.|     .:.:.|..|| :|  :|..:
E. coli   243 LGHSGCRIGGNDLDIALAFKNLMPLLGMGGETEKGIALPILPWWNAVAINDVPAQSDFYSSANGR 307

  Fly   281 TKTDVTTSPR------ALAKLFKEAGRLKNVLSANTEFFAQIENLIEDIDFKLPVTREKLEQLCE 339
            ...|:....|      .|.|::::  ||...|..:.|......:.:.:....||....:|..|..
E. coli   308 LLNDLVRDAREPEKVALLQKVWRQ--RLSYRLVRSAEECKIALSSVAETRASLPFISNELATLIS 370

  Fly   340 D--LWPRATKPLEEALASSHLSLDVINQ----VILFGGGTRVPRVQETIKAVIKQ 388
            .  |....::||...|....|:||...:    :.|.||..|.|.::   ||:.:|
E. coli   371 QRGLESALSQPLTRILEQVQLALDNAQEKPDVIYLTGGSARSPLIK---KALAEQ 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2918NP_001162645.1 HSP70 22..625 CDD:278441 90/445 (20%)
HYOU1-like_NBD 23..409 CDD:212672 90/445 (20%)
TAF4 <572..>627 CDD:296797
yegDNP_416573.4 PRK11678 1..450 CDD:236954 90/445 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.