DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2918 and Ankrd45

DIOPT Version :9

Sequence 1:NP_001162645.1 Gene:CG2918 / 31215 FlyBaseID:FBgn0023529 Length:923 Species:Drosophila melanogaster
Sequence 2:XP_030099044.2 Gene:Ankrd45 / 73844 MGIID:1921094 Length:313 Species:Mus musculus


Alignment Length:297 Identity:59/297 - (19%)
Similarity:100/297 - (33%) Gaps:80/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 LDDSGIFRCTGVE-------YVYEKQKPEDDADEDSTLSKFGSTLSKLFTKEGE-EKKDNSEQEE 585
            |.|.|:..|.|..       :..|..:||:..:.:       |:...||:.:.| |:...:|:..
Mouse    37 LRDPGVRGCRGGRHPRYFFFFFLELMEPEETLESE-------SSEKSLFSSQQEYEESQEAEETG 94

  Fly   586 AANAGEEPSKS----------EDNEKAKEEDASKEQKSEESTKQD------TEAKNETIKLVTVK 634
            |.|...:|:.:          ||.|....|.|.:....|:...::      ...|::.||.: .|
Mouse    95 AENPLLQPTLTGDVEGLQKIFEDPEHPHHEHAVQLLLEEDIVGRNLLYAACMAGKSDVIKAL-AK 158

  Fly   635 SPVTYESQTQFVVPLVGSAYDQSVAKLAAINKAEEQR--VRLESAFNALEAHIIEVQQKLDEESY 697
            ..|.....|.....|:..|        ||..:.|..:  |.|:....||.....:.:......|.
Mouse   159 YGVNLNEATARGYTLLHCA--------AAWGRLETLKALVELDVDIEALNFRGEKARDVAARYSQ 215

  Fly   698 AKCAT---------------------------------AEEKEKLLAECSTLGEWLYEDLEDPKA 729
            .:|..                                 .|:|..:|..|....|||....|...:
Mouse   216 VECVNFLDWADARLILKKIITKSSLIITDPEKGPGKLFKEDKSTILNACRLKNEWLESHPEASIS 280

  Fly   730 EIYEEKLAQLKKLSNVFLARHWEHEERPEAIKALKGM 766
            ||:|:| .||:.:.:..||:    ...|..:|:.|.:
Mouse   281 EIFEQK-QQLEDIVSPILAK----MSTPRQVKSAKSI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2918NP_001162645.1 HSP70 22..625 CDD:278441 23/119 (19%)
HYOU1-like_NBD 23..409 CDD:212672
TAF4 <572..>627 CDD:296797 13/71 (18%)
Ankrd45XP_030099044.2 Ank_2 123..200 CDD:403870 17/85 (20%)
ANK repeat 137..167 CDD:293786 5/30 (17%)
ANK repeat 169..200 CDD:293786 8/38 (21%)
PTZ00009 <246..300 CDD:240227 16/58 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.