DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2918 and anp32b

DIOPT Version :9

Sequence 1:NP_001162645.1 Gene:CG2918 / 31215 FlyBaseID:FBgn0023529 Length:923 Species:Drosophila melanogaster
Sequence 2:NP_001025567.1 Gene:anp32b / 594955 XenbaseID:XB-GENE-988727 Length:267 Species:Xenopus tropicalis


Alignment Length:387 Identity:81/387 - (20%)
Similarity:133/387 - (34%) Gaps:157/387 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 IQLRLRDYLAQEFNALKKTKTDVTTSPRALAKLFKEAGRLKNVLS--ANTEFFAQIENLIEDIDF 325
            |.|.||:          :|.:||  ....|.......|:::.:.:  .|.||.:.|..|:..:. 
 Frog     7 IHLELRN----------RTPSDV--RELVLDNCRAHEGKIEGLTAEFVNLEFLSLINVLLMSVS- 58

  Fly   326 KLPVTREKLEQLCEDLWPRATKPLEEALASSHLSLDVINQVILFGGGTRVPRVQETIKAVIKQEL 390
            .||    ||.:|         |.||  |:.:.:|           ||..|  :.|.:..:....|
 Frog    59 NLP----KLPKL---------KKLE--LSDNRIS-----------GGLDV--LAEKLSNLTHLNL 95

  Fly   391 GKNLNADESATMGAVYKAADLSAGFKVKKF-VVKDATLFPLQVSFERDPGDGAAVKQVKRALFAL 454
            ..|             |..|:|....:||. .:|...||..:|:...|         .:.::|.|
 Frog    96 SGN-------------KIKDISTLEPLKKLESLKSLDLFNCEVTNLND---------YRESVFKL 138

  Fly   455 MNPYPQKKVITFNKHTDDFEFYVNYADLDRYSKEEIAALGSLNVTKVQLKQVKELLEKSKKELVD 519
            :   ||   :|:               ||.|.:|:                         ||..|
 Frog   139 L---PQ---LTY---------------LDGYDRED-------------------------KEAPD 157

  Fly   520 NKGIKAYFYLDDSGIFRCTGVEYVYEKQKPEDDADEDSTLSKFGSTLSKLFTKEGEEKKDNSEQE 584
            :..       :..|    .||:...|.::.||:.:::.              :||||::|..|:|
 Frog   158 SDA-------EADG----DGVDEEEEDEEGEDEEEDEE--------------EEGEEEEDVDEEE 197

  Fly   585 EAANAGEEPSKSEDNEKAK-------------------EEDASKEQKSEESTKQDTEAKNET 627
            :.....||..:.||.|.|.                   |||..::::.|||.|.: :.|.||
 Frog   198 DDDEDEEEIGEEEDEEDASGEEEEEDFGHDGEVDEDDDEEDDEEDEEEEESGKGE-KRKRET 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2918NP_001162645.1 HSP70 22..625 CDD:278441 78/383 (20%)
HYOU1-like_NBD 23..409 CDD:212672 31/147 (21%)
TAF4 <572..>627 CDD:296797 21/73 (29%)
anp32bNP_001025567.1 LRR_9 <71..146 CDD:373143 23/130 (18%)
leucine-rich repeat 90..114 CDD:275380 7/36 (19%)
leucine-rich repeat 115..141 CDD:275380 7/37 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165162151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.