DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2918 and SDH3-2

DIOPT Version :9

Sequence 1:NP_001162645.1 Gene:CG2918 / 31215 FlyBaseID:FBgn0023529 Length:923 Species:Drosophila melanogaster
Sequence 2:NP_194948.2 Gene:SDH3-2 / 3770570 AraportID:AT4G32210 Length:213 Species:Arabidopsis thaliana


Alignment Length:196 Identity:35/196 - (17%)
Similarity:74/196 - (37%) Gaps:31/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LAGIA--------LSQGAAVMSVDLGSEWMKVGVVSPGVPMEIAL--NRESKRKTPAILAFRDGT 65
            |||.|        :.|..|..|...||:.:...::..|:....|:  .||..:.|.|.:.....|
plant    26 LAGNAQPSWGSSYIGQNYASFSRAFGSKPVVNDILGTGLGTNNAIREEREKSKSTEAAIVGAQLT 90

  Fly    66 RTIGEDAQTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTVVFRKSDTDE 130
            |:.    :.:.:......:..:...:..|.:.|.:..:|...|:.::. .|:.|:::        
plant    91 RSF----RALDVGTSKRLFSTISGDIKTTQEEPKIKSFRPLSPHLSVY-QPQMNSML-------- 142

  Fly   131 FSVEELVAQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAA 195
             |:...::.:.:....||...:...:....||.|.::     :.|....|  .|.|:..:...||
plant   143 -SIFNRISGVYLTGVTFAGYLLYLKMGMICLTYPSFY-----QVLYHTQQ--QLPVITSVTALAA 199

  Fly   196 V 196
            :
plant   200 I 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2918NP_001162645.1 HSP70 22..625 CDD:278441 29/177 (16%)
HYOU1-like_NBD 23..409 CDD:212672 29/176 (16%)
TAF4 <572..>627 CDD:296797
SDH3-2NP_194948.2 SQR_QFR_TM 1..213 CDD:412626 35/196 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.