DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2918 and ANKRD45

DIOPT Version :9

Sequence 1:NP_001162645.1 Gene:CG2918 / 31215 FlyBaseID:FBgn0023529 Length:923 Species:Drosophila melanogaster
Sequence 2:XP_016856612.1 Gene:ANKRD45 / 339416 HGNCID:24786 Length:286 Species:Homo sapiens


Alignment Length:306 Identity:73/306 - (23%)
Similarity:113/306 - (36%) Gaps:81/306 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DLYR--KRFPYYNIV---GDPERNTVVFRKSDTDEFSVEELVAQLLVKAKQFAQESVQQPITECV 160
            |.||  |.|.:..::   |.||..:..|.....:|...||        |::..:...:.|:.:..
Human     7 DFYRIWKLFVFLELMESEGPPESESSEFFSQQEEENEEEE--------AQEPEETGPKNPLLQPA 63

  Fly   161 LT--VPG---YFGQAEREALLSAAQL--------ANLKVLQLI---NDYAAVALNYGVFHRGEIN 209
            ||  |.|   .|...|......|.||        .||.....:   :|.......|||    .:|
Human    64 LTGDVEGLQKIFEDPENPHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGV----NLN 124

  Fly   210 E--TAQYFLFYDMGAY---KTSAAVVSYQL------VKDKQTREINPVVQVLGVGYDRT-----L 258
            |  |..|.|.:...|:   :|..|:|...:      .::::.|::       ...|.:|     |
Human   125 EKTTRGYTLLHCAAAWGRLETLKALVELDVDIEALNFREERARDV-------AARYSQTECVEFL 182

  Fly   259 GGLEIQLRLRDYLAQEFNALKKTKTDVTTSPRALAKLFKE-------AGRLKNV-LSANTEFFAQ 315
            ...:.:|.|:.|:|       |....||.:.:...||.||       |.|.||. |..:||  |.
Human   183 DWADARLTLKKYIA-------KVSLAVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTE--AS 238

  Fly   316 IENLIEDIDFKLPVTREKLEQLCEDLWPRATKPLEEALASSHLSLD 361
            |..|.|.        |::||.:...::.:.|.|.:...|.|..|.|
Human   239 INELFEQ--------RQQLEDIVTPIFTKMTTPCQVKSAKSVTSHD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2918NP_001162645.1 HSP70 22..625 CDD:278441 73/306 (24%)
HYOU1-like_NBD 23..409 CDD:212672 73/306 (24%)
TAF4 <572..>627 CDD:296797
ANKRD45XP_016856612.1 ANK repeat 58..94 CDD:293786 10/35 (29%)
ANK 94..>182 CDD:238125 18/98 (18%)
Ank_4 97..150 CDD:290365 14/56 (25%)
ANK repeat 97..127 CDD:293786 8/33 (24%)
ANK repeat 129..160 CDD:293786 6/30 (20%)
Ank_4 130..182 CDD:290365 9/58 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.