DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2918 and SLC9C2

DIOPT Version :9

Sequence 1:NP_001162645.1 Gene:CG2918 / 31215 FlyBaseID:FBgn0023529 Length:923 Species:Drosophila melanogaster
Sequence 2:XP_011507728.1 Gene:SLC9C2 / 284525 HGNCID:28664 Length:1129 Species:Homo sapiens


Alignment Length:578 Identity:105/578 - (18%)
Similarity:186/578 - (32%) Gaps:208/578 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 YNIVGDPERNTVVFRKSDTDEFSV--EELVAQLLVKAKQFAQESVQQPITECVLTVPGYFGQAER 172
            :|::..|:...:..||.:..:..:  .::::.|.:....:......:.:..|||::|       |
Human   384 FNLLWAPDVYNLAERKVEVPQMFILYVQVISLLTMGINSYVMTQSARKLDLCVLSLP-------R 441

  Fly   173 EALLSAAQLANLKVLQLINDYAAVALNYGVFHRGEINETAQYFLFYDMGAYKTSAAV--VSYQLV 235
            :.:|   |.|...:.:::.:...:                          :||...:  |::.||
Human   442 QMIL---QNATQHIQEIVQNTITL--------------------------FKTEKILTNVNWTLV 477

  Fly   236 KDKQTREINP----------------------------VVQVLGVGYDRTLGGLEIQ-LRLRDYL 271
            :||...|..|                            .:|:......|..|.|||: .|:....
Human   478 EDKTRIEYIPFSHVSHNDMKTESTTDEALMEEARLHVAAIQMSSFEKQRNNGILEIEAARILIGA 542

  Fly   272 AQEFNALK---KTKTDVTTSPRALAKLFKEAGRLKNVLSANTEFFAQIENLIEDIDFKLP----- 328
            |:.:.:::   .:..||:|..|..:.|.|    .||||:.       :|..||.|.|..|     
Human   543 AKCYYSIQGKFMSIYDVSTYMRTRSWLIK----FKNVLTF-------LEYCIEKIHFIPPESNTF 596

  Fly   329 -------VTREKLE------------QLCEDLWPRATKPLEEALAS------------SHLSLDV 362
                   |..|:.|            .:...|||.|......||.|            |.|.:.:
Human   597 LTFIFHIVFSEEFEYTGQIINLIYIYPMIIHLWPMARGLNVSALISINYYFMFLYVLESTLKIII 661

  Fly   363 INQ-------------VILFG--------------------------GGTRVPRVQETIKAVI-- 386
            :.:             :::.|                          |..|:.|.....|.::  
Human   662 LKRKYFQQCWNTLEFFILVIGIIDIFCVYFVKLRPDNLALIQLTVIMGYLRIIRFLPLFKIIVPI 726

  Fly   387 -----KQELGKNLNADESATMGAVYKAADLSAGFKVKKFVVKDATLFPLQVSFERDPGDGAAVKQ 446
                 ..::.|.|:...|.|.|.:....|  |...:|:..|.::....|....|.:..|  |||:
Human   727 LIRIADVQIKKRLSLMYSITKGYIKSQED--AKLLIKQIAVCESIYQKLCEILETNKQD--AVKE 787

  Fly   447 V-------KRALFALMNPYPQKKVITFNKHTDDFEFYVNYADLDRYSKEEIAALGSLNVTKVQLK 504
            :       :..:.||......:.||.  |...:..|..:...:|   |.|:     :.:.||.||
Human   788 LVLMEHEGRDVVIALKTKQAIRNVIA--KALKNLTFLCSRGIID---KHEV-----IEINKVLLK 842

  Fly   505 QVKEL---------------------LEKSKKELVDNKGIKAYFYLDDSGIFRCTGVE 541
            ::|.|                     || .|..|:|....:|.....|||...|.|.|
Human   843 KLKALNNFPKAIPPPTPDIYLHNIIWLE-GKDVLIDFFKERAKLACFDSGDTICKGGE 899

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2918NP_001162645.1 HSP70 22..625 CDD:278441 105/578 (18%)
HYOU1-like_NBD 23..409 CDD:212672 68/416 (16%)
TAF4 <572..>627 CDD:296797
SLC9C2XP_011507728.1 Na_H_Exchanger 98..380 CDD:294713
Ion_trans 638..>731 CDD:278921 10/92 (11%)
CAP_ED 873..980 CDD:237999 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.