DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2918 and HSPA12A

DIOPT Version :9

Sequence 1:NP_001162645.1 Gene:CG2918 / 31215 FlyBaseID:FBgn0023529 Length:923 Species:Drosophila melanogaster
Sequence 2:NP_001317093.1 Gene:HSPA12A / 259217 HGNCID:19022 Length:692 Species:Homo sapiens


Alignment Length:421 Identity:88/421 - (20%)
Similarity:141/421 - (33%) Gaps:168/421 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 DYAAVALNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDKQTREINPVVQVLGVGYDR 256
            ||....|.|.:|  ||.        |.:....|..||.|...:..:.:.|...|         ||
Human   369 DYEFEKLLYKIF--GED--------FIEQFKIKRPAAWVDLMIAFESRKRAAAP---------DR 414

  Fly   257 TLGGLEIQLRLR--DYLAQEF------NALKKTKTD---------VTTSPRALAKLFKEAGRLKN 304
            | ..|.|.|...  ||. ::|      :||:|:..|         :..||.|:..|||..     
Human   415 T-NPLNITLPFSFIDYY-KKFRGHSVEHALRKSNVDFVKWSSQGMLRMSPDAMNALFKPT----- 472

  Fly   305 VLSANTEFFAQIENLIEDIDFKLPVTREKLEQLCEDLWPRATKPLEEALASSHLSLDVINQVILF 369
                       |:::||.:               .||:   .||          .:..:..:.|.
Human   473 -----------IDSIIEHL---------------RDLF---QKP----------EVSTVKFLFLV 498

  Fly   370 GGGTRVPRVQETIKA--------VIKQELGKNLNADESATMGAVYKAADLSAGFKVKKFVVKDAT 426
            ||....|.:|:.::|        :|.|::|..                           ::|.|.
Human   499 GGFAEAPLLQQAVQAAFGDQCRIIIPQDVGLT---------------------------ILKGAV 536

  Fly   427 LFPLQVSFERDPGDGAAVKQVKRALF----ALMNPY------PQKKVITFNKH--TDDFEFYVNY 479
            ||.|      ||    ||.:|:|:..    .::|.|      |:|.::.....  ||.|:.::  
Human   537 LFGL------DP----AVIKVRRSPLTYGVGVLNRYVEGKHPPEKLLVKDGTRWCTDVFDKFI-- 589

  Fly   480 ADLDRYSKEEIAALGSL---NVTKVQLKQVKELLEKSKKELVDNKGIKAYFYLDDSGIFRC---- 537
                  |.::..|||.|   :.|..:..|:..::.....| .||..     ::.|.|:.:|    
Human   590 ------SADQSVALGELVKRSYTPAKPSQLVIVINIYSSE-HDNVS-----FITDPGVKKCGTLR 642

  Fly   538 ---TGVEYVYEKQKPEDDADEDSTLSKFGST 565
               ||........:     .|..||.:||.|
Human   643 LDLTGTSGTAVPAR-----REIQTLMQFGDT 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2918NP_001162645.1 HSP70 22..625 CDD:278441 88/421 (21%)
HYOU1-like_NBD 23..409 CDD:212672 49/241 (20%)
TAF4 <572..>627 CDD:296797
HSPA12ANP_001317093.1 HSPA12A_like_NBD 74..540 CDD:212685 53/262 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.