DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2918 and HSPA12B

DIOPT Version :9

Sequence 1:NP_001162645.1 Gene:CG2918 / 31215 FlyBaseID:FBgn0023529 Length:923 Species:Drosophila melanogaster
Sequence 2:NP_443202.3 Gene:HSPA12B / 116835 HGNCID:16193 Length:686 Species:Homo sapiens


Alignment Length:153 Identity:38/153 - (24%)
Similarity:60/153 - (39%) Gaps:41/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KRKTPA-----ILAFRDGTRTIG-EDAQTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYY 110
            ||:.||     .:||....||.| ..|..:.|..|.|                .:|.|||: ..:
Human   377 KRQRPAAWVDLTIAFEARKRTAGPHRAGALNISLPFS----------------FIDFYRKQ-RGH 424

  Fly   111 NIVGDPERNTVVFRKSDTDEFSVEELVAQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREAL 175
            |:.....|::|.|.|..          :|.:::....|...:.||      ||.|.....  |||
Human   425 NVETALRRSSVNFVKWS----------SQGMLRMSCEAMNELFQP------TVSGIIQHI--EAL 471

  Fly   176 LSAAQLANLKVLQLINDYAAVAL 198
            |:..::..:|:|.|:..:|..|:
Human   472 LARPEVQGVKLLFLVGGFAESAV 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2918NP_001162645.1 HSP70 22..625 CDD:278441 38/153 (25%)
HYOU1-like_NBD 23..409 CDD:212672 38/153 (25%)
TAF4 <572..>627 CDD:296797
HSPA12BNP_443202.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 12..53
NBD_sugar-kinase_HSP70_actin 61..529 CDD:327376 38/153 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.