DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and UBE2Q2

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_775740.1 Gene:UBE2Q2 / 92912 HGNCID:19248 Length:375 Species:Homo sapiens


Alignment Length:405 Identity:214/405 - (52%)
Similarity:291/405 - (71%) Gaps:49/405 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKQEIKTLEKIFPKNHERFQILNSSVDELLCRF-IDKNGKRYD------IHANITETYPSSPPVW 64
            ||.|:|.|..||.||||||:|::..:|||.|:| :.:.|..:.      :|.||||:||||.|:|
Human     6 LKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIW 70

  Fly    65 FAESEETSVTNAVQILSNTNGRDNHVI-NQVGILLRELCRLHNVPLPPDIDNLALPLQTPPPSAS 128
            |.:||:.::|:.::.|.:|  ::|::: .|:..|:.|||.|:|:|...|::.|..||.|      
Human    71 FVDSEDPNLTSVLERLEDT--KNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPT------ 127

  Fly   129 PLRCEQRPGGGGAGGGGGPHG-NEETDSDQEEIEDPIGESEQESEGDEDL---PLEMDDVRSTSK 189
                             |.:| .||..|::||      |.|:.:|..|||   .::.::..|..|
Human   128 -----------------GQNGTTEEVTSEEEE------EEEEMAEDIEDLDHYEMKEEEPISGKK 169

  Fly   190 KDD--MEVEHLATLEKLRQSQRQDYLKGSVSGSVQATDRLMKELRDIYRSDAFKKNMYSIELVNE 252
            .:|  :|.|:||.|||:|::||||:|.|:|||||||:|||||||||||||.::|..:||:||:|:
Human   170 SEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELIND 234

  Fly   253 SIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLNILFKETYPFEPPFVRVVHPIISGGYVLI 317
            |:|:|:::|:.||||||||||||:||||||.:.||||..||:.:||:|||||||.|::||||||.
Human   235 SLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLG 299

  Fly   318 GGAICMELLTKQGWSSAYTVEAVIMQIAATLVKGKARIQFGATKALTQGQYSLARAQQSFKSLVQ 382
            |||:||||||||||||||::|:|||||.|||||||||:||||.|    .||:|||||||:.|:||
Human   300 GGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANK----NQYNLARAQQSYNSIVQ 360

  Fly   383 IHEKNGWFTPPKEDG 397
            |||||||:|||||||
Human   361 IHEKNGWYTPPKEDG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 88/124 (71%)
UBE2Q2NP_775740.1 RWD 9..94 CDD:322051 36/86 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..174 19/79 (24%)
UBCc 206..362 CDD:238117 112/159 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 226 1.000 Domainoid score I2522
eggNOG 1 0.900 - - E1_KOG0897
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45455
Inparanoid 1 1.050 399 1.000 Inparanoid score I1946
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49199
OrthoDB 1 1.010 - - D1214134at2759
OrthoFinder 1 1.000 - - FOG0003048
OrthoInspector 1 1.000 - - otm41365
orthoMCL 1 0.900 - - OOG6_104870
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4130
SonicParanoid 1 1.000 - - X2030
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.