DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and UBE2L6

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_004214.1 Gene:UBE2L6 / 9246 HGNCID:12490 Length:153 Species:Homo sapiens


Alignment Length:166 Identity:36/166 - (21%)
Similarity:71/166 - (42%) Gaps:32/166 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 VQATDRLMKELRDIYRS-DAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKD 284
            :.|:.|::|||.|:.:. ..:.:|:.|.:   .::..|:..|.   ||.|.:.    ||      
Human     1 MMASMRVVKELEDLQKKPPPYLRNLSSDD---ANVLVWHALLL---PDQPPYH----LK------ 49

  Fly   285 SILLNILFKETYPFEPPFV----RVVHPIISGGYVLIGGAICMELLTKQGW----SSAYTVEAVI 341
            :..|.|.|...|||:||.:    ::.||.:..     .|.||:.:::.:.|    .:...:||:.
Human    50 AFNLRISFPPEYPFKPPMIKFTTKIYHPNVDE-----NGQICLPIISSENWKPCTKTCQVLEALN 109

  Fly   342 MQIAATLVKGKARIQFGATKALTQGQYSLARAQQSF 377
            :.:....::...|:..  ...|||......:..:.|
Human   110 VLVNRPNIREPLRMDL--ADLLTQNPELFRKNAEEF 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 30/133 (23%)
UBE2L6NP_004214.1 UQ_con 6..144 CDD:306648 35/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143140
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.