DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and CDC34

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_010339.1 Gene:CDC34 / 851624 SGDID:S000002461 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:48/198 - (24%)
Similarity:82/198 - (41%) Gaps:49/198 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 ATDRLMKELRDIYRSDAFKKNM--YSIELVNES-IYEWNIRLKSVDPDSPLHSDLQMLKEKEGKD 284
            |:..|:::.|::  :|. ||.:  :.|||.::| |:.|||.:..::.||..|...          
Yeast     8 ASSLLLRQYREL--TDP-KKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGF---------- 59

  Fly   285 SILLNILFKETYPFEPPFVR----VVHPIISGGYVLIGGAICMELLTKQG-----------WSSA 334
             ....:.|.|.:||.||..|    :.||     .|...|.:|:.:|.:.|           ||..
Yeast    60 -FKAQMRFPEDFPFSPPQFRFTPAIYHP-----NVYRDGRLCISILHQSGDPMTDEPDAETWSPV 118

  Fly   335 YTVEAVIMQIAATL----VKGKARIQFGATKALTQGQYSLARAQQSFKSLVQIHEKN---GWFTP 392
            .|||:|::.|.:.|    :...|.:...........||     :|..|..|:..:::   |:..|
Yeast   119 QTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQY-----KQRVKMEVERSKQDIPKGFIMP 178

  Fly   393 PKE 395
            ..|
Yeast   179 TSE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 38/146 (26%)
CDC34NP_010339.1 COG5078 3..170 CDD:227410 45/185 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.