DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and UBE2E2

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001357154.1 Gene:UBE2E2 / 7325 HGNCID:12478 Length:201 Species:Homo sapiens


Alignment Length:208 Identity:49/208 - (23%)
Similarity:84/208 - (40%) Gaps:60/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 SDQEEIEDPIGESEQESEGDEDLPLEMDDVRSTSKKDDMEVEHLATLEKLRQSQRQDYLKGSVSG 219
            ::.:.::|....|...|:||:...::.:..|                |:::..:::    |.:|.
Human     3 TEAQRVDDSPSTSGGSSDGDQRESVQQEPER----------------EQVQPKKKE----GKISS 47

  Fly   220 SVQA-----TDRLMKELRDIY-----RSDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDL 274
            ...|     ..|:.|||.:|.     ...|..|        .::||||  |...:.|...::   
Human    48 KTAAKLSTSAKRIQKELAEITLDPPPNCSAGPK--------GDNIYEW--RSTILGPPGSVY--- 99

  Fly   275 QMLKEKEGKDSILLNILFKETYPFEPPFV----RVVHPIISGGYVLIGGAICMELLTKQGWSSAY 335
                  || ....|:|.|...|||:||.|    |:.|..|:.     .|.||:::| |..||.|.
Human   100 ------EG-GVFFLDITFSPDYPFKPPKVTFRTRIYHCNINS-----QGVICLDIL-KDNWSPAL 151

  Fly   336 TVEAVIMQIAATL 348
            |:..|::.|.:.|
Human   152 TISKVLLSICSLL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 39/134 (29%)
UBE2E2NP_001357154.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 10/71 (14%)
UQ_con 59..196 CDD:395127 39/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.