Sequence 1: | NP_001284819.1 | Gene: | CG2924 / 31214 | FlyBaseID: | FBgn0023528 | Length: | 397 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003332.1 | Gene: | UBE2E1 / 7324 | HGNCID: | 12477 | Length: | 193 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 52/206 - (25%) |
---|---|---|---|
Similarity: | 78/206 - (37%) | Gaps: | 61/206 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 152 ETDSDQEEIEDPIGESEQESEGDEDLPLEMDDVRSTSKKDDMEVEHLATLEKLRQSQRQDYLKGS 216
Fly 217 VSGSVQATDRLMKELRDIY-----RSDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQM 276
Fly 277 LKEKEGKDSILLNILFKETYPFEPPFV----RVVHPIISGGYVLIGGAICMELLTKQGWSSAYTV 337
Fly 338 EAVIMQIAATL 348 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2924 | NP_001284819.1 | UBCc | 224..>349 | CDD:238117 | 40/134 (30%) |
UBE2E1 | NP_003332.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..45 | 9/45 (20%) | |
UQ_con | 51..188 | CDD:395127 | 40/132 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |