DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and UBE2D3

DIOPT Version :10

Sequence 1:NP_569994.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_871622.1 Gene:UBE2D3 / 7323 HGNCID:12476 Length:149 Species:Homo sapiens


Alignment Length:126 Identity:37/126 - (29%)
Similarity:56/126 - (44%) Gaps:25/126 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 LMKELRDIYRSDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLNIL 291
            |.|||.|:.|....:   .|...|.:.::.|...:...: |||....:           ..|.|.
Human     8 LSKELSDLARDPPAQ---CSAGPVGDDMFHWQATIMGPN-DSPYQGGV-----------FFLTIH 57

  Fly   292 FKETYPFEPPFV----RVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATL 348
            |...|||:||.|    |:.||.|:.     .|:||:::|..| ||.|.|:..|::.|.:.|
Human    58 FPTDYPFKPPKVAFTTRIYHPNINS-----NGSICLDILRSQ-WSPALTISKVLLSICSLL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_569994.1 UBCc_UBE2Q 225..384 CDD:467422 37/126 (29%)
UBE2D3NP_871622.1 UBCc_UBE2D 6..147 CDD:467412 37/126 (29%)

Return to query results.
Submit another query.