DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and UBE2D2

DIOPT Version :10

Sequence 1:NP_569994.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_047273646.1 Gene:UBE2D2 / 7322 HGNCID:12475 Length:173 Species:Homo sapiens


Alignment Length:123 Identity:35/123 - (28%)
Similarity:54/123 - (43%) Gaps:25/123 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 ELRDIYRSDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLNILFKE 294
            ||.|:.|....:   .|...|.:.::.|...:...: |||....:           ..|.|.|..
Human    35 ELNDLARDPPAQ---CSAGPVGDDMFHWQATIMGPN-DSPYQGGV-----------FFLTIHFPT 84

  Fly   295 TYPFEPPFV----RVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATL 348
            .|||:||.|    |:.||.|:.     .|:||:::|..| ||.|.|:..|::.|.:.|
Human    85 DYPFKPPKVAFTTRIYHPNINS-----NGSICLDILRSQ-WSPALTISKVLLSICSLL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_569994.1 UBCc_UBE2Q 225..384 CDD:467422 35/123 (28%)
UBE2D2XP_047273646.1 UBCc_UBE2D 35..171 CDD:467412 35/123 (28%)

Return to query results.
Submit another query.