DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and Ube2q1

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_081591.3 Gene:Ube2q1 / 70093 MGIID:1917343 Length:422 Species:Mus musculus


Alignment Length:417 Identity:208/417 - (49%)
Similarity:274/417 - (65%) Gaps:61/417 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKQEIKTLEKIFPKNHERFQILNSSVDELLCRFI---------------------DKNGKRYDIH 50
            |::|:|.||.||.:.||||:|.::.:|||.|.|:                     ...|....||
Mouse    41 LRRELKLLESIFHRGHERFRIASACLDELSCEFLLAGAGGAGAGAAPGPHLPSRGSVPGDPVRIH 105

  Fly    51 ANITETYPSSPPVWFAESEETSVTNAVQILSNTNGRDNHVINQVGILLRELCRLHNVPLPPDIDN 115
            .||||:||:.||:|..||::.::...::.|.:....:..::..:..::.:||:|:|:|..||::.
Mouse   106 CNITESYPAVPPIWSVESDDPNLAAVLERLVDIKKGNTLLLQHLKRIISDLCKLYNLPQHPDVEM 170

  Fly   116 LALPLQTPPPSASPLRCEQRPGGGGAGGGGGPHGNEETDSDQEEIEDPIGESEQESEGDEDLP-L 179
            |..||...       :|.|                ||..|:.|:.|.|        |..|||. .
Mouse   171 LDQPLPAE-------QCTQ----------------EEVSSEDEDEEMP--------EDTEDLDHY 204

  Fly   180 EMDDVR----STSKKDDMEVEHLATLEKLRQSQRQDYLKGSVSGSVQATDRLMKELRDIYRSDAF 240
            ||.:..    ..|:.|.:..|:||.|||::::||||||.|:|||||||||||||||||||||.:|
Mouse   205 EMKEEEPAEGKKSEDDGIGKENLAILEKIKKNQRQDYLNGAVSGSVQATDRLMKELRDIYRSQSF 269

  Fly   241 KKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLNILFKETYPFEPPFVRV 305
            |...|::||||:|:|:||::|..||.||.||:|||:||||||.|.||||..||:.:||:||||||
Mouse   270 KGGNYAVELVNDSLYDWNVKLLKVDQDSALHNDLQILKEKEGADFILLNFSFKDNFPFDPPFVRV 334

  Fly   306 VHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATLVKGKARIQFGATKALTQGQYSL 370
            |.|::||||||.||||||||||||||||||::|:|||||:|||||||||:||||.|:    ||||
Mouse   335 VSPVLSGGYVLGGGAICMELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKS----QYSL 395

  Fly   371 ARAQQSFKSLVQIHEKNGWFTPPKEDG 397
            .|||||:||||||||||||:|||||||
Mouse   396 TRAQQSYKSLVQIHEKNGWYTPPKEDG 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 90/124 (73%)
Ube2q1NP_081591.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..221 17/78 (22%)
UBCc 253..409 CDD:238117 116/159 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 210 1.000 Domainoid score I2815
eggNOG 1 0.900 - - E1_KOG0897
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 388 1.000 Inparanoid score I1994
Isobase 1 0.950 - 0 Normalized mean entropy S1963
OMA 1 1.010 - - QHG49199
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003048
OrthoInspector 1 1.000 - - otm43422
orthoMCL 1 0.900 - - OOG6_104870
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4130
SonicParanoid 1 1.000 - - X2030
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.810

Return to query results.
Submit another query.