DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and Ube2ql1

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001138635.1 Gene:Ube2ql1 / 679949 RGDID:1598121 Length:304 Species:Rattus norvegicus


Alignment Length:345 Identity:125/345 - (36%)
Similarity:165/345 - (47%) Gaps:88/345 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LLRE--LCRLHNVPLPPDIDNLALPLQTPPPSASPLRCEQRPGGGGA-------GGGGGPHGNEE 152
            |||:  |.||||                 ..:..|.......||||.       |.|||..|..:
  Rat     4 LLRKIGLIRLHN-----------------RDTEDPKHHHNHRGGGGGQQSASLRGKGGGKSGGHK 51

  Fly   153 TDSDQEEIEDPIGESEQESEGDEDLPLEMDDVRSTSKKDDMEVEHLATLEKLRQSQR-------- 209
               .|::.:.| |.|...|.|             ..|........||..:|..|...        
  Rat    52 ---QQQQQQHP-GGSGDASPG-------------PGKGKSKRAAELAARDKQPQPAAGAAGVAGA 99

  Fly   210 ---QDYLKGSVSGSVQA-----------------------TDRLMKELRDIYR-SDAFKKNMYSI 247
               ::...|:.:|...|                       :.||||||:||.| ||.|    .|:
  Rat   100 GGPRERAAGARAGPGPAVAAAAAGGSLVPAARQQHCTQVRSRRLMKELQDIARLSDRF----ISV 160

  Fly   248 ELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLNILFKETYPFEPPFVRVVHPIISG 312
            |||||::::||::|..||.||.|..|:    ::...:.||||:.|.:.:||.|||:||:.|.:..
  Rat   161 ELVNENLFDWNVKLHQVDKDSVLWQDM----KETNTEFILLNLTFPDNFPFSPPFMRVLSPRLEN 221

  Fly   313 GYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATLVKGKARIQFGATKALTQGQYSLARAQQSF 377
            ||||.||||||||||.:|||||||||||:.|.||:||||:.||...|.|  ::..:|...|:.:|
  Rat   222 GYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGRICRKAGK--SKKSFSRKEAEATF 284

  Fly   378 KSLVQIHEKNGWFTPPKEDG 397
            ||||:.|||.||.|||..||
  Rat   285 KSLVKTHEKYGWVTPPVSDG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 68/125 (54%)
Ube2ql1NP_001138635.1 UBCc 140..>258 CDD:238117 68/125 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0897
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.