DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and Ube2d3

DIOPT Version :10

Sequence 1:NP_569994.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_036019109.1 Gene:Ube2d3 / 66105 MGIID:1913355 Length:148 Species:Mus musculus


Alignment Length:130 Identity:38/130 - (29%)
Similarity:58/130 - (44%) Gaps:25/130 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 ATDRLMKELRDIYRSDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSIL 287
            |..|:.|||.|:.|....:   .|...|.:.::.|...:...: |||....:           ..
Mouse     2 ALKRINKELSDLARDPPAQ---CSAGPVGDDMFHWQATIMGPN-DSPYQGGV-----------FF 51

  Fly   288 LNILFKETYPFEPPFV----RVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATL 348
            |.|.|...|||:||.|    |:.||.|:.     .|:||:::|..| ||.|.|:..|::.|.:.|
Mouse    52 LTIHFPTDYPFKPPKVAFTTRIYHPNINS-----NGSICLDILRSQ-WSPALTISKVLLSICSLL 110

  Fly   349  348
            Mouse   111  110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_569994.1 UBCc_UBE2Q 225..384 CDD:467422 37/128 (29%)
Ube2d3XP_036019109.1 UBCc_UBE2D 3..145 CDD:467412 37/129 (29%)

Return to query results.
Submit another query.