DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and UBE2Q1

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_060052.3 Gene:UBE2Q1 / 55585 HGNCID:15698 Length:422 Species:Homo sapiens


Alignment Length:412 Identity:202/412 - (49%)
Similarity:274/412 - (66%) Gaps:51/412 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKQEIKTLEKIFPKNHERFQILNSSVDELLCRFI---------------------DKNGKRYDIH 50
            |::|:|.||.||.:.||||:|.::.:|||.|.|:                     ...|....||
Human    41 LRRELKLLESIFHRGHERFRIASACLDELSCEFLLAGAGGAGAGAAPGPHLPPRGSVPGDPVRIH 105

  Fly    51 ANITETYPSSPPVWFAESEETSVTNAVQILSNTNGRDNHVINQVGILLRELCRLHNVPLPPDIDN 115
            .||||:||:.||:|..||::.::...::.|.:....:..::..:..::.:||:|:|:|..||::.
Human   106 CNITESYPAVPPIWSVESDDPNLAAVLERLVDIKKGNTLLLQHLKRIISDLCKLYNLPQHPDVEM 170

  Fly   116 LALPLQTPPPSASPLRCEQRPGGGGAGGGGGPHGNEETDSDQEEIEDPIGESEQESEGDEDLPLE 180
            |..||.....:...:..|..              :||...|.|:::....:.|:.:||.:     
Human   171 LDQPLPAEQCTQEDVSSEDE--------------DEEMPEDTEDLDHYEMKEEEPAEGKK----- 216

  Fly   181 MDDVRSTSKKDDMEVEHLATLEKLRQSQRQDYLKGSVSGSVQATDRLMKELRDIYRSDAFKKNMY 245
                   |:.|.:..|:||.|||::::||||||.|:|||||||||||||||||||||.:||...|
Human   217 -------SEDDGIGKENLAILEKIKKNQRQDYLNGAVSGSVQATDRLMKELRDIYRSQSFKGGNY 274

  Fly   246 SIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLNILFKETYPFEPPFVRVVHPII 310
            ::||||:|:|:||::|..||.||.||:|||:||||||.|.||||..||:.:||:|||||||.|::
Human   275 AVELVNDSLYDWNVKLLKVDQDSALHNDLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVL 339

  Fly   311 SGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATLVKGKARIQFGATKALTQGQYSLARAQQ 375
            ||||||.||||||||||||||||||::|:|||||:|||||||||:||||.|:    ||||.||||
Human   340 SGGYVLGGGAICMELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKS----QYSLTRAQQ 400

  Fly   376 SFKSLVQIHEKNGWFTPPKEDG 397
            |:||||||||||||:|||||||
Human   401 SYKSLVQIHEKNGWYTPPKEDG 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 90/124 (73%)
UBE2Q1NP_060052.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..221 11/72 (15%)
UBCc 253..409 CDD:412187 116/159 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 226 1.000 Domainoid score I2522
eggNOG 1 0.900 - - E1_KOG0897
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 399 1.000 Inparanoid score I1946
Isobase 1 0.950 - 0 Normalized mean entropy S1963
OMA 1 1.010 - - QHG49199
OrthoDB 1 1.010 - - D1214134at2759
OrthoFinder 1 1.000 - - FOG0003048
OrthoInspector 1 1.000 - - otm41365
orthoMCL 1 0.900 - - OOG6_104870
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4130
SonicParanoid 1 1.000 - - X2030
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.820

Return to query results.
Submit another query.