powered by:
Protein Alignment CG2924 and CG14739
DIOPT Version :9
Sequence 1: | NP_001284819.1 |
Gene: | CG2924 / 31214 |
FlyBaseID: | FBgn0023528 |
Length: | 397 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_650151.1 |
Gene: | CG14739 / 41467 |
FlyBaseID: | FBgn0037987 |
Length: | 206 |
Species: | Drosophila melanogaster |
Alignment Length: | 48 |
Identity: | 19/48 - (39%) |
Similarity: | 26/48 - (54%) |
Gaps: | 1/48 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 288 LNILFKETYPFEPPFVRVVHPIISGGYVLIGGAICMELLTKQGWSSAY 335
:|:...:.||...|.||.|..|:......|.|.:||.:| ||.|||:|
Fly 60 VNVTMPQDYPLTAPRVRFVTKILHPNIEFITGLVCMNVL-KQAWSSSY 106
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR24068 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.