DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and Ubc4

DIOPT Version :10

Sequence 1:NP_569994.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:130 Identity:44/130 - (33%)
Similarity:66/130 - (50%) Gaps:21/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 ATDRLMKELRDIYRSDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSIL 287
            |..|:.:|.:::.||:...:....|||||:|..|....:.. .||:|...         ||  .:
  Fly     5 AVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAG-PPDTPYEG---------GK--FV 57

  Fly   288 LNILFKETYPFEPPFVRVV----HPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATL 348
            |.|...|||||.||.||.:    ||.||.    :.||||:::| |..|::|.|:..|::.:.|.|
  Fly    58 LEIKVPETYPFNPPKVRFITRIWHPNISS----VTGAICLDIL-KDNWAAAMTLRTVLLSLQALL 117

  Fly   349  348
              Fly   118  117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_569994.1 UBCc_UBE2Q 225..384 CDD:467422 43/128 (34%)
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 43/129 (33%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.