DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and Ubc4

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:130 Identity:44/130 - (33%)
Similarity:66/130 - (50%) Gaps:21/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 ATDRLMKELRDIYRSDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSIL 287
            |..|:.:|.:::.||:...:....|||||:|..|....:.. .||:|...         ||  .:
  Fly     5 AVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAG-PPDTPYEG---------GK--FV 57

  Fly   288 LNILFKETYPFEPPFVRVV----HPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATL 348
            |.|...|||||.||.||.:    ||.||.    :.||||:::| |..|::|.|:..|::.:.|.|
  Fly    58 LEIKVPETYPFNPPKVRFITRIWHPNISS----VTGAICLDIL-KDNWAAAMTLRTVLLSLQALL 117

  Fly   349  348
              Fly   118  117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 43/129 (33%)
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 44/130 (34%)
UQ_con 8..149 CDD:278603 43/127 (34%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.