DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and Uev1A

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster


Alignment Length:162 Identity:30/162 - (18%)
Similarity:59/162 - (36%) Gaps:43/162 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 STSKKDDMEVEHLATLEKLRQSQRQDYLKGSVSGSVQATDRLMKELRDIYRSDAFKKNMYSIELV 250
            :||....:...:...||:|.|.|     ||...|::.                      :.:|..
  Fly     3 NTSSTGVVVPRNFRLLEELDQGQ-----KGVGDGTIS----------------------WGLEND 40

  Fly   251 NESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLNILFKETYPFEPPFVRVVHPIISGGYV 315
            ::....:.|.:....|.:|..:.:..||.:.|           |.||.|||.:|.:..:......
  Fly    41 DDMTLTYWIGMIIGPPRTPFENRMYSLKIECG-----------ERYPDEPPTLRFITKVNINCIN 94

  Fly   316 LIGGAI---CMELLTKQGWSSAYTVEAVIMQI 344
            ...|.:   .:::|.:  ||..|.::.::.:|
  Fly    95 QNNGVVDHRSVQMLAR--WSREYNIKTMLQEI 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 20/124 (16%)
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 28/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.