DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and CG10862

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:221 Identity:47/221 - (21%)
Similarity:87/221 - (39%) Gaps:50/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 EDLPLEMDDVRST-SKKDDMEVEHLATLEKLRQSQRQDYLKGSVSGSVQATDRLMKELRDIYRSD 238
            |::|  ||:...| |.:.:..|..|..:|....:|          |......||.:|:.: :.:|
  Fly   172 ENVP--MDETFDTESLQSNSLVLRLFRIESGIPTQ----------GDPLTITRLRREISE-FSTD 223

  Fly   239 AFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLNILFKETYPFEPPFV 303
              :......|:|.::::.|...:..  |...::         || ....:.|:|...|||.||::
  Fly   224 --QTEGCKAEMVGDNLFHWVATIPG--PSETVY---------EG-GRFRVEIVFPRNYPFYPPYL 274

  Fly   304 RVVHPIISGGY---VLIGGAICMELLTKQGWSSAYTVEAVIMQIAATLVKGKARIQFGATKALTQ 365
                ..::..|   :.:.|.||:::|..: ||.|.:|..|::.|.:.|...........:.|   
  Fly   275 ----AFLTKTYHCNIALSGRICLDILGSK-WSPALSVSKVLISIMSLLADPNPHDPMEVSVA--- 331

  Fly   366 GQYSLARAQQSFKSLVQIHEKNG--W 389
                     ..||....:|:||.  |
  Fly   332 ---------DVFKGNRALHDKNAREW 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 28/127 (22%)
CG10862NP_647823.1 COG5078 207..354 CDD:227410 36/174 (21%)
UQ_con 212..349 CDD:278603 36/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.