DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and Ube2q2

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_038938304.1 Gene:Ube2q2 / 363065 RGDID:1307680 Length:382 Species:Rattus norvegicus


Alignment Length:348 Identity:183/348 - (52%)
Similarity:249/348 - (71%) Gaps:39/348 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ETYPSSPPVWFAESEETSVTNAVQILSNTNGRDNHVINQVGILLRELCRLHNVPLPPDIDNLALP 119
            |:||||.|:||.:|::.::|:.::.|.:|. .::.:..|:..|:.:||||:|:|...|::.|..|
  Rat    69 ESYPSSSPIWFVDSDDPNLTSVLERLEDTK-NNSSLRQQLKWLICDLCRLYNLPKHLDVEMLDQP 132

  Fly   120 LQTPPPSASPLRCEQRPGGGGAGGGGGPHGNEETDSDQEEIEDPIGESEQESEGDEDLP----LE 180
            |.|                       |.:|..|..:.:||      |.|:.:|..|||.    .|
  Rat   133 LPT-----------------------GQNGTTEEVTSEEE------EEEEMAEDIEDLDHYEMKE 168

  Fly   181 MDDVRSTSKKDD-MEVEHLATLEKLRQSQRQDYLKGSVSGSVQATDRLMKELRDIYRSDAFKKNM 244
            .:.:.....:|: :|.|:||.|||:|::||||:|.|:|||||||:|||||||||:|||.::|..:
  Rat   169 EEPINGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDVYRSQSYKAGI 233

  Fly   245 YSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLNILFKETYPFEPPFVRVVHPI 309
            ||:||:|:|:|:|:::|..||.|||||||||:||||||.:.||||..||:.:||:|||||||.|:
  Rat   234 YSVELINDSLYDWHVKLHKVDSDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPV 298

  Fly   310 ISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATLVKGKARIQFGATKALTQGQYSLARAQ 374
            :||||||.|||:||||||||||||||::|:|||||.|||||||||:||||.|    .||:|||||
  Rat   299 LSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANK----NQYNLARAQ 359

  Fly   375 QSFKSLVQIHEKNGWFTPPKEDG 397
            ||:.|:|||||||||:|||||||
  Rat   360 QSYNSIVQIHEKNGWYTPPKEDG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 86/124 (69%)
Ube2q2XP_038938304.1 UBCc 213..369 CDD:238117 110/159 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 215 1.000 Domainoid score I2633
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45455
Inparanoid 1 1.050 386 1.000 Inparanoid score I1951
OMA 1 1.010 - - QHG49199
OrthoDB 1 1.010 - - D1214134at2759
OrthoFinder 1 1.000 - - FOG0003048
OrthoInspector 1 1.000 - - otm45488
orthoMCL 1 0.900 - - OOG6_104870
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2030
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.