DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and Ubc2

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:257 Identity:58/257 - (22%)
Similarity:85/257 - (33%) Gaps:96/257 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NVPLPP-----DIDNLALPLQTPPPSASPLRCEQRPGGGGAGGGGGPHGNEETDSDQEEIEDPIG 165
            |.|..|     ::.|.:.|.....|.|.        ||.|:...||..|:               
  Fly    21 NAPSAPSTTASNVSNTSQPTTAGTPQAR--------GGRGSNANGGASGS--------------- 62

  Fly   166 ESEQESEGDEDLPLEMDDVRSTSKKDDMEVEHLATLEKLRQSQRQDYLKGSVSGSVQATDRLMKE 230
                 :.|..|.|      |..:|........|.|..|                      |:.||
  Fly    63 -----NAGGGDEP------RKEAKTTPRISRALGTSAK----------------------RIQKE 94

  Fly   231 LRDIY-----RSDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLNI 290
            |.:|.     ...|..|        .:::|||...:  :.|...::         || ....|:|
  Fly    95 LAEITLDPPPNCSAGPK--------GDNLYEWVSTI--LGPPGSVY---------EG-GVFFLDI 139

  Fly   291 LFKETYPFEPPFV----RVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATL 348
            .|...|||:||.|    |:.|..|:.     .|.||:::| |..||.|.|:..|::.|.:.|
  Fly   140 HFSPEYPFKPPKVTFRTRIYHCNINS-----QGVICLDIL-KDNWSPALTISKVLLSICSLL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 37/134 (28%)
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 39/158 (25%)
UQ_con 90..227 CDD:278603 37/132 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.